SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145598599|ref|YP_001162675.1| from Yersinia pestis Pestoides F

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145598599|ref|YP_001162675.1|
Domain Number 1 Region: 26-331
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.3e-60
Family L-arabinose binding protein-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|145598599|ref|YP_001162675.1|
Sequence length 331
Comment sugar-binding periplasmic protein [Yersinia pestis Pestoides F]
Sequence
MMIKKLCLIAALVFSLGIMGAYAQRSQSIVTVVKVIGEPWYTRMGEGAKEFGDENPSIST
RTVGPARADSALQLRIVEDLIAKKVDALAVAPMDPSTLEGALKKAMSRGIIVVTNEAYDM
VNMHADIEAVDNATFGAKMNEGLVNCMGESGKWTTFVGSLGTNNHVLWAKSAAVNAQKYP
NMTLVDPLNESFNDANRAYDKAKEIMRKYPDIKGFQGHSAIDVIGIGRAVEEAGLQGKIC
VFGIGLPQDSGKYLDSGAINGISFWDPKDASLAMDTVAKLLLDKKPLTDGMNLGVPGYEN
VAIRKGKGDGVLVIGDAAKFVDKTNWQQYPF
Download sequence
Identical sequences A0A0E1P0C3 A0A0H2W3X4 A0A0H2YJD3 A0A0H3B473 A0A0M1V5I8 A0A0T9KAF1 A0A0U1ER84 A0A0U1QWC5 A0A208S9S4 Q66BT1 Q7CHY5
gi|145598599|ref|YP_001162675.1| gi|170024635|ref|YP_001721140.1| gi|384414947|ref|YP_005624309.1| gi|45441398|ref|NP_992937.1| gi|294504019|ref|YP_003568081.1| gi|384122199|ref|YP_005504819.1| gi|22126377|ref|NP_669800.1| WP_002211125.1.100083 WP_002211125.1.100246 WP_002211125.1.10066 WP_002211125.1.100921 WP_002211125.1.100931 WP_002211125.1.10105 WP_002211125.1.101305 WP_002211125.1.101382 WP_002211125.1.101928 WP_002211125.1.102012 WP_002211125.1.102067 WP_002211125.1.10736 WP_002211125.1.10935 WP_002211125.1.10955 WP_002211125.1.11693 WP_002211125.1.12167 WP_002211125.1.12463 WP_002211125.1.12736 WP_002211125.1.12857 WP_002211125.1.1388 WP_002211125.1.14063 WP_002211125.1.14169 WP_002211125.1.14804 WP_002211125.1.15321 WP_002211125.1.15555 WP_002211125.1.15605 WP_002211125.1.15689 WP_002211125.1.16243 WP_002211125.1.16333 WP_002211125.1.17135 WP_002211125.1.17141 WP_002211125.1.17608 WP_002211125.1.17873 WP_002211125.1.17983 WP_002211125.1.18208 WP_002211125.1.18640 WP_002211125.1.18826 WP_002211125.1.19329 WP_002211125.1.19425 WP_002211125.1.19739 WP_002211125.1.19763 WP_002211125.1.20035 WP_002211125.1.20547 WP_002211125.1.2064 WP_002211125.1.20932 WP_002211125.1.21486 WP_002211125.1.21784 WP_002211125.1.21879 WP_002211125.1.21934 WP_002211125.1.22530 WP_002211125.1.22542 WP_002211125.1.22708 WP_002211125.1.23157 WP_002211125.1.23271 WP_002211125.1.23687 WP_002211125.1.23811 WP_002211125.1.24002 WP_002211125.1.2451 WP_002211125.1.24517 WP_002211125.1.25181 WP_002211125.1.25394 WP_002211125.1.26383 WP_002211125.1.2640 WP_002211125.1.26776 WP_002211125.1.26960 WP_002211125.1.27124 WP_002211125.1.2726 WP_002211125.1.28647 WP_002211125.1.28922 WP_002211125.1.29157 WP_002211125.1.29355 WP_002211125.1.2947 WP_002211125.1.29622 WP_002211125.1.2964 WP_002211125.1.29685 WP_002211125.1.29814 WP_002211125.1.3092 WP_002211125.1.30931 WP_002211125.1.311 WP_002211125.1.31336 WP_002211125.1.31496 WP_002211125.1.31739 WP_002211125.1.31805 WP_002211125.1.32343 WP_002211125.1.32388 WP_002211125.1.32446 WP_002211125.1.32736 WP_002211125.1.33203 WP_002211125.1.33324 WP_002211125.1.33661 WP_002211125.1.33937 WP_002211125.1.34031 WP_002211125.1.34138 WP_002211125.1.35538 WP_002211125.1.36088 WP_002211125.1.37174 WP_002211125.1.37494 WP_002211125.1.37863 WP_002211125.1.38235 WP_002211125.1.38532 WP_002211125.1.38743 WP_002211125.1.38824 WP_002211125.1.38993 WP_002211125.1.39066 WP_002211125.1.39346 WP_002211125.1.3976 WP_002211125.1.40071 WP_002211125.1.40134 WP_002211125.1.40534 WP_002211125.1.40853 WP_002211125.1.41196 WP_002211125.1.41984 WP_002211125.1.42976 WP_002211125.1.44408 WP_002211125.1.44598 WP_002211125.1.44603 WP_002211125.1.44832 WP_002211125.1.45198 WP_002211125.1.45214 WP_002211125.1.46262 WP_002211125.1.46545 WP_002211125.1.46686 WP_002211125.1.46697 WP_002211125.1.46731 WP_002211125.1.4678 WP_002211125.1.46891 WP_002211125.1.47387 WP_002211125.1.47440 WP_002211125.1.47769 WP_002211125.1.47881 WP_002211125.1.48166 WP_002211125.1.48722 WP_002211125.1.4889 WP_002211125.1.49315 WP_002211125.1.49906 WP_002211125.1.4997 WP_002211125.1.50010 WP_002211125.1.50093 WP_002211125.1.50106 WP_002211125.1.50185 WP_002211125.1.50984 WP_002211125.1.51284 WP_002211125.1.51293 WP_002211125.1.51588 WP_002211125.1.51772 WP_002211125.1.51934 WP_002211125.1.52158 WP_002211125.1.52247 WP_002211125.1.52473 WP_002211125.1.52569 WP_002211125.1.52792 WP_002211125.1.52819 WP_002211125.1.52969 WP_002211125.1.53147 WP_002211125.1.53300 WP_002211125.1.53838 WP_002211125.1.53848 WP_002211125.1.53883 WP_002211125.1.53953 WP_002211125.1.54568 WP_002211125.1.54951 WP_002211125.1.55194 WP_002211125.1.55695 WP_002211125.1.5592 WP_002211125.1.56031 WP_002211125.1.56912 WP_002211125.1.56953 WP_002211125.1.57585 WP_002211125.1.57657 WP_002211125.1.58067 WP_002211125.1.58543 WP_002211125.1.58794 WP_002211125.1.59102 WP_002211125.1.59431 WP_002211125.1.5957 WP_002211125.1.59635 WP_002211125.1.59687 WP_002211125.1.59789 WP_002211125.1.59885 WP_002211125.1.60437 WP_002211125.1.60707 WP_002211125.1.60896 WP_002211125.1.61689 WP_002211125.1.62342 WP_002211125.1.6270 WP_002211125.1.6333 WP_002211125.1.63387 WP_002211125.1.63641 WP_002211125.1.64142 WP_002211125.1.64474 WP_002211125.1.64780 WP_002211125.1.64786 WP_002211125.1.64910 WP_002211125.1.653 WP_002211125.1.65400 WP_002211125.1.65554 WP_002211125.1.6570 WP_002211125.1.65718 WP_002211125.1.6581 WP_002211125.1.66118 WP_002211125.1.66546 WP_002211125.1.66616 WP_002211125.1.67404 WP_002211125.1.67850 WP_002211125.1.6791 WP_002211125.1.68361 WP_002211125.1.68371 WP_002211125.1.68855 WP_002211125.1.69018 WP_002211125.1.69316 WP_002211125.1.69951 WP_002211125.1.70117 WP_002211125.1.70171 WP_002211125.1.70319 WP_002211125.1.70377 WP_002211125.1.70417 WP_002211125.1.70726 WP_002211125.1.7083 WP_002211125.1.71744 WP_002211125.1.72280 WP_002211125.1.72440 WP_002211125.1.72486 WP_002211125.1.7402 WP_002211125.1.74131 WP_002211125.1.74310 WP_002211125.1.74577 WP_002211125.1.74738 WP_002211125.1.75173 WP_002211125.1.7518 WP_002211125.1.75208 WP_002211125.1.75337 WP_002211125.1.75407 WP_002211125.1.75636 WP_002211125.1.75689 WP_002211125.1.75821 WP_002211125.1.76555 WP_002211125.1.76670 WP_002211125.1.77387 WP_002211125.1.77429 WP_002211125.1.77691 WP_002211125.1.78004 WP_002211125.1.7841 WP_002211125.1.78556 WP_002211125.1.7939 WP_002211125.1.79515 WP_002211125.1.79550 WP_002211125.1.79609 WP_002211125.1.79981 WP_002211125.1.8009 WP_002211125.1.80331 WP_002211125.1.81848 WP_002211125.1.81877 WP_002211125.1.8210 WP_002211125.1.82133 WP_002211125.1.82151 WP_002211125.1.82270 WP_002211125.1.82436 WP_002211125.1.82619 WP_002211125.1.8303 WP_002211125.1.83039 WP_002211125.1.83265 WP_002211125.1.83630 WP_002211125.1.8420 WP_002211125.1.84703 WP_002211125.1.84720 WP_002211125.1.85269 WP_002211125.1.85270 WP_002211125.1.8559 WP_002211125.1.85802 WP_002211125.1.86034 WP_002211125.1.86059 WP_002211125.1.86413 WP_002211125.1.87107 WP_002211125.1.8728 WP_002211125.1.87418 WP_002211125.1.8762 WP_002211125.1.87853 WP_002211125.1.87988 WP_002211125.1.88362 WP_002211125.1.88472 WP_002211125.1.89359 WP_002211125.1.89542 WP_002211125.1.90176 WP_002211125.1.9051 WP_002211125.1.90624 WP_002211125.1.91373 WP_002211125.1.91844 WP_002211125.1.92030 WP_002211125.1.92331 WP_002211125.1.92604 WP_002211125.1.927 WP_002211125.1.9311 WP_002211125.1.9320 WP_002211125.1.93623 WP_002211125.1.93928 WP_002211125.1.93933 WP_002211125.1.94052 WP_002211125.1.94201 WP_002211125.1.94545 WP_002211125.1.94683 WP_002211125.1.95746 WP_002211125.1.95981 WP_002211125.1.97245 WP_002211125.1.97375 WP_002211125.1.97448 WP_002211125.1.97791 WP_002211125.1.97864 WP_002211125.1.97872 WP_002211125.1.97894 WP_002211125.1.99109 WP_002211125.1.99383 WP_002211125.1.9941 WP_002211125.1.99416 WP_002211125.1.99788 WP_002211125.1.99882 YP_002346808.1.25044 gi|186895126|ref|YP_001872238.1| gi|51596022|ref|YP_070213.1| gi|218928933|ref|YP_002346808.1| gi|384140297|ref|YP_005522999.1| gi|153947912|ref|YP_001401278.1| gi|108807184|ref|YP_651100.1| gi|108812472|ref|YP_648239.1| gi|384126405|ref|YP_005509019.1| 187410.y2494 214092.YPO1813 229193.YP_1580 273123.YPTB1686 349747.YpsIP31758_2309 360102.YPA_1188 377628.YPN_2311 386656.YPDSF_1311 502800.YPK_2410 502801.YPTS_1814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]