SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145598678|ref|YP_001162754.1| from Yersinia pestis Pestoides F

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145598678|ref|YP_001162754.1|
Domain Number 1 Region: 57-319
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.04e-40
Family L-arabinose binding protein-like 0.00037
Further Details:      
 
Domain Number 2 Region: 2-58
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 2.69e-16
Family GalR/LacI-like bacterial regulator 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|145598678|ref|YP_001162754.1|
Sequence length 338
Comment hypothetical protein YPDSF_1392 [Yersinia pestis Pestoides F]
Sequence
MSLKKIANELGLSSTTVSRALNGYDDVAAETRERIIDAAKRLGYQPNSLARRLKMGRTDA
IALAYPSRPRVLNNSTFLEMISWIGIELGKRGLDLLLIPDEPGEKYQSLIHLVETRRVDA
LIVAHTQPEDFRLQYLQKQNFPFLALGRSHLPKPYAWFDFDNHAGASLAVKRLLELGHQR
IAFVSTDARISYVDQRLQGYVQTMSEAGLMPLAGYLQKADPTRPGGYLAASRLLALEVPP
TAIITDCNMLGDGVASALDKAGLLGGEGISLIAYDGLPDDSLLDIAVTPIVQNTRTSVGK
QIASMICDLLGGKDPKELQVLWQPEIGEGETDGVNRRG
Download sequence
Identical sequences A0A0H3B4Y6 A0A0U1ES32 A0A0U1QXZ3 A0A2A7VGE5 Q66C06
gi|153948594|ref|YP_001401362.1| WP_002230719.1.100083 WP_002230719.1.10066 WP_002230719.1.10736 WP_002230719.1.10935 WP_002230719.1.11693 WP_002230719.1.12167 WP_002230719.1.12736 WP_002230719.1.1388 WP_002230719.1.14169 WP_002230719.1.15555 WP_002230719.1.16243 WP_002230719.1.17141 WP_002230719.1.17608 WP_002230719.1.18208 WP_002230719.1.19329 WP_002230719.1.19425 WP_002230719.1.20380 WP_002230719.1.20547 WP_002230719.1.20932 WP_002230719.1.21784 WP_002230719.1.23687 WP_002230719.1.2451 WP_002230719.1.24517 WP_002230719.1.25181 WP_002230719.1.26383 WP_002230719.1.27124 WP_002230719.1.29622 WP_002230719.1.2964 WP_002230719.1.29685 WP_002230719.1.29814 WP_002230719.1.3092 WP_002230719.1.30931 WP_002230719.1.311 WP_002230719.1.31336 WP_002230719.1.32736 WP_002230719.1.33324 WP_002230719.1.33661 WP_002230719.1.34138 WP_002230719.1.37174 WP_002230719.1.37494 WP_002230719.1.38235 WP_002230719.1.38532 WP_002230719.1.38824 WP_002230719.1.38993 WP_002230719.1.3976 WP_002230719.1.39858 WP_002230719.1.40534 WP_002230719.1.41984 WP_002230719.1.4210 WP_002230719.1.42361 WP_002230719.1.42976 WP_002230719.1.44408 WP_002230719.1.46697 WP_002230719.1.46731 WP_002230719.1.47440 WP_002230719.1.47769 WP_002230719.1.47881 WP_002230719.1.49315 WP_002230719.1.50185 WP_002230719.1.51284 WP_002230719.1.51772 WP_002230719.1.52473 WP_002230719.1.52792 WP_002230719.1.52969 WP_002230719.1.53147 WP_002230719.1.53883 WP_002230719.1.56031 WP_002230719.1.58543 WP_002230719.1.59885 WP_002230719.1.60707 WP_002230719.1.60896 WP_002230719.1.6270 WP_002230719.1.6333 WP_002230719.1.63641 WP_002230719.1.6570 WP_002230719.1.67850 WP_002230719.1.6791 WP_002230719.1.68371 WP_002230719.1.68753 WP_002230719.1.72280 WP_002230719.1.72486 WP_002230719.1.7402 WP_002230719.1.74131 WP_002230719.1.74310 WP_002230719.1.74738 WP_002230719.1.75208 WP_002230719.1.75337 WP_002230719.1.75636 WP_002230719.1.76555 WP_002230719.1.76670 WP_002230719.1.78004 WP_002230719.1.8009 WP_002230719.1.82133 WP_002230719.1.82436 WP_002230719.1.83039 WP_002230719.1.83630 WP_002230719.1.86059 WP_002230719.1.87107 WP_002230719.1.8762 WP_002230719.1.89359 WP_002230719.1.89542 WP_002230719.1.90624 WP_002230719.1.91263 WP_002230719.1.91373 WP_002230719.1.92030 WP_002230719.1.93623 WP_002230719.1.95746 WP_002230719.1.97864 WP_002230719.1.99882 gi|186895041|ref|YP_001872153.1| gi|145598678|ref|YP_001162754.1| gi|51595946|ref|YP_070137.1| gi|170024716|ref|YP_001721221.1| 273123.YPTB1610 349747.YpsIP31758_2393 386656.YPDSF_1392 502800.YPK_2491 502801.YPTS_1729 NYSGXRC-11234o

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]