SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145598741|ref|YP_001162817.1| from Yersinia pestis Pestoides F

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145598741|ref|YP_001162817.1|
Domain Number 1 Region: 40-305
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.53e-38
Family L-arabinose binding protein-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|145598741|ref|YP_001162817.1|
Sequence length 358
Comment sugar ABC transporter [Yersinia pestis Pestoides F]
Sequence
MKKIAYPILALSLLTALPVFAADPVTLAPVPDAIANHQGQIKIAVIRNLGSDDNTTQFLS
GVLKEGKKLGFKVDTFLSNGDDARFQDFVNQAISQKYDGIILSQGRDPYSTELVKRITDN
GIAVSVFDTAIQGEIPGLTVTQQDDASLTNESFGQLIKDFDGNANIIKLWVAGFPPMERR
QAAYQALLKQNPGIIELESIGAVSSDVQGDTANKVGAVLAKYPKGKIDAIWGTWDAFTQG
AYKALQENGRTEIKLYSIDISNQDLQLMREANSPWKVSVAVDPKLIGAINLRLIAKKIAG
ETTPASYEFRAASIPQALLASQPGPVNVAGLSKIIPGWGQSDDFNSPWFATLAAQNGQ
Download sequence
Identical sequences A0A0E1NUI4 A0A0H2YIR0 A0A0M1V2Z3 A0A154S1W3 Q66C74
gi|108806809|ref|YP_650725.1| gi|294503494|ref|YP_003567556.1| gi|108812622|ref|YP_648389.1| 273123.YPTB1532 349746.YpAngola_A3029 360102.YPA_0812 377628.YPN_2461 386656.YPDSF_1457 gi|384140600|ref|YP_005523302.1| gi|384126060|ref|YP_005508674.1| gi|162419303|ref|YP_001607396.1| gi|384121941|ref|YP_005504561.1| gi|384415106|ref|YP_005624468.1| gi|145598741|ref|YP_001162817.1| WP_002211975.1.66118 gi|51595869|ref|YP_070060.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]