SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145598754|ref|YP_001162830.1| from Yersinia pestis Pestoides F

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145598754|ref|YP_001162830.1|
Domain Number 1 Region: 25-329
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.34e-84
Family L-arabinose binding protein-like 0.0000000000721
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|145598754|ref|YP_001162830.1|
Sequence length 330
Comment galactose-binding protein [Yersinia pestis Pestoides F]
Sequence
MNKKVFTLAALVTSMMVGAYAQAETRIGVTIYKYDDNFMSVVRKAIEKDAKASPEITLLM
NDSQNDQSKQNDQIDVLLAKGVKALAINLVDPAAAPVVIDKARSNDIPIVFYNKEPSRKA
LDSYDKAYYVGTDSKESGVIQGELIAKHWQANPEWDLNKDGKIQFVLLKGEPGHPDAEAR
TTYVIKTLNEKGLPTQQLQLDTAMWDTAQAKDKMDAWLSGPNANKIEVVIANNDAMAMGA
VEALKAHNKTSVPVFGVDALPEALALVKSGQMAGTVLNDANNQAKATFDLAKNLAAGKPA
AEGTTWKIENKIVRIPYVGVDKDNLAEFTK
Download sequence
Identical sequences A0A0E1P0H3 A0A0H2YIS1 A0A0H3B4N0 A0A0M1V327 A0A0U1ERK1 A0A0U1QXB2 A0A154SBD6 A0A208RYD1 A0A2A7VGL0 Q66C84
gi|384121931|ref|YP_005504551.1| gi|384415118|ref|YP_005624480.1| 273123.YPTB1522 349746.YpAngola_A3017 349747.YpsIP31758_2467 360102.YPA_0802 377628.YPN_2472 386656.YPDSF_1470 502800.YPK_2566 502801.YPTS_1632 gi|108812633|ref|YP_648400.1| gi|186894946|ref|YP_001872058.1| gi|145598754|ref|YP_001162830.1| gi|384126070|ref|YP_005508684.1| gi|153948321|ref|YP_001401436.1| gi|162418532|ref|YP_001607385.1| gi|51595859|ref|YP_070050.1| gi|108806799|ref|YP_650715.1| gi|294503484|ref|YP_003567546.1| WP_002211963.1.100083 WP_002211963.1.100246 WP_002211963.1.100593 WP_002211963.1.10066 WP_002211963.1.100921 WP_002211963.1.101382 WP_002211963.1.102012 WP_002211963.1.102067 WP_002211963.1.10736 WP_002211963.1.10935 WP_002211963.1.10955 WP_002211963.1.11693 WP_002211963.1.12167 WP_002211963.1.12736 WP_002211963.1.12857 WP_002211963.1.1388 WP_002211963.1.14169 WP_002211963.1.14804 WP_002211963.1.15321 WP_002211963.1.15555 WP_002211963.1.15689 WP_002211963.1.16243 WP_002211963.1.16333 WP_002211963.1.17141 WP_002211963.1.17608 WP_002211963.1.18208 WP_002211963.1.18826 WP_002211963.1.19425 WP_002211963.1.19763 WP_002211963.1.20380 WP_002211963.1.20547 WP_002211963.1.2064 WP_002211963.1.20932 WP_002211963.1.21784 WP_002211963.1.21879 WP_002211963.1.21934 WP_002211963.1.22530 WP_002211963.1.22542 WP_002211963.1.23687 WP_002211963.1.23811 WP_002211963.1.24002 WP_002211963.1.2451 WP_002211963.1.24517 WP_002211963.1.25181 WP_002211963.1.25394 WP_002211963.1.26383 WP_002211963.1.26776 WP_002211963.1.27124 WP_002211963.1.28647 WP_002211963.1.28922 WP_002211963.1.29157 WP_002211963.1.29186 WP_002211963.1.29355 WP_002211963.1.2947 WP_002211963.1.29622 WP_002211963.1.2964 WP_002211963.1.29685 WP_002211963.1.29814 WP_002211963.1.3092 WP_002211963.1.30931 WP_002211963.1.311 WP_002211963.1.31336 WP_002211963.1.31721 WP_002211963.1.31739 WP_002211963.1.31805 WP_002211963.1.32388 WP_002211963.1.32736 WP_002211963.1.33203 WP_002211963.1.33324 WP_002211963.1.33661 WP_002211963.1.33775 WP_002211963.1.34031 WP_002211963.1.34138 WP_002211963.1.36088 WP_002211963.1.37174 WP_002211963.1.37494 WP_002211963.1.38235 WP_002211963.1.38532 WP_002211963.1.38743 WP_002211963.1.38824 WP_002211963.1.38993 WP_002211963.1.39346 WP_002211963.1.3976 WP_002211963.1.39858 WP_002211963.1.40071 WP_002211963.1.40534 WP_002211963.1.40853 WP_002211963.1.41196 WP_002211963.1.4210 WP_002211963.1.42976 WP_002211963.1.44408 WP_002211963.1.44598 WP_002211963.1.44832 WP_002211963.1.46262 WP_002211963.1.46697 WP_002211963.1.46731 WP_002211963.1.4678 WP_002211963.1.46891 WP_002211963.1.47440 WP_002211963.1.47769 WP_002211963.1.47881 WP_002211963.1.48166 WP_002211963.1.4889 WP_002211963.1.49315 WP_002211963.1.49906 WP_002211963.1.50185 WP_002211963.1.50984 WP_002211963.1.51284 WP_002211963.1.51772 WP_002211963.1.52247 WP_002211963.1.52473 WP_002211963.1.52792 WP_002211963.1.52969 WP_002211963.1.53147 WP_002211963.1.53300 WP_002211963.1.53848 WP_002211963.1.53883 WP_002211963.1.54568 WP_002211963.1.5592 WP_002211963.1.56031 WP_002211963.1.56912 WP_002211963.1.56953 WP_002211963.1.57585 WP_002211963.1.57657 WP_002211963.1.58543 WP_002211963.1.58794 WP_002211963.1.5968 WP_002211963.1.59687 WP_002211963.1.59789 WP_002211963.1.59885 WP_002211963.1.60437 WP_002211963.1.60707 WP_002211963.1.60896 WP_002211963.1.6270 WP_002211963.1.6333 WP_002211963.1.63387 WP_002211963.1.63641 WP_002211963.1.64474 WP_002211963.1.64780 WP_002211963.1.653 WP_002211963.1.65554 WP_002211963.1.6570 WP_002211963.1.6581 WP_002211963.1.66546 WP_002211963.1.67404 WP_002211963.1.67850 WP_002211963.1.6791 WP_002211963.1.68371 WP_002211963.1.68753 WP_002211963.1.68855 WP_002211963.1.69316 WP_002211963.1.69951 WP_002211963.1.70117 WP_002211963.1.70726 WP_002211963.1.7083 WP_002211963.1.72280 WP_002211963.1.72440 WP_002211963.1.72486 WP_002211963.1.7402 WP_002211963.1.74131 WP_002211963.1.74310 WP_002211963.1.74577 WP_002211963.1.74738 WP_002211963.1.75169 WP_002211963.1.7518 WP_002211963.1.75208 WP_002211963.1.75337 WP_002211963.1.75407 WP_002211963.1.75636 WP_002211963.1.75689 WP_002211963.1.76555 WP_002211963.1.76670 WP_002211963.1.77295 WP_002211963.1.77569 WP_002211963.1.77691 WP_002211963.1.78004 WP_002211963.1.7841 WP_002211963.1.79515 WP_002211963.1.79550 WP_002211963.1.79825 WP_002211963.1.8009 WP_002211963.1.8210 WP_002211963.1.82133 WP_002211963.1.82270 WP_002211963.1.82436 WP_002211963.1.83039 WP_002211963.1.83265 WP_002211963.1.83630 WP_002211963.1.84703 WP_002211963.1.85269 WP_002211963.1.85270 WP_002211963.1.85802 WP_002211963.1.86059 WP_002211963.1.86413 WP_002211963.1.87107 WP_002211963.1.8728 WP_002211963.1.8762 WP_002211963.1.87853 WP_002211963.1.88362 WP_002211963.1.88472 WP_002211963.1.89359 WP_002211963.1.89542 WP_002211963.1.90176 WP_002211963.1.9051 WP_002211963.1.90624 WP_002211963.1.91373 WP_002211963.1.91844 WP_002211963.1.92030 WP_002211963.1.92331 WP_002211963.1.92604 WP_002211963.1.927 WP_002211963.1.9311 WP_002211963.1.93623 WP_002211963.1.93928 WP_002211963.1.94052 WP_002211963.1.94545 WP_002211963.1.95746 WP_002211963.1.95981 WP_002211963.1.97245 WP_002211963.1.97864 WP_002211963.1.97872 WP_002211963.1.99383 WP_002211963.1.9941 WP_002211963.1.99416 WP_002211963.1.99788 WP_002211963.1.99882 WP_002211963.1.99972 gi|170024791|ref|YP_001721296.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]