SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145599173|ref|YP_001163249.1| from Yersinia pestis Pestoides F

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145599173|ref|YP_001163249.1|
Domain Number 1 Region: 67-327
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.71e-41
Family L-arabinose binding protein-like 0.0004
Further Details:      
 
Domain Number 2 Region: 6-58
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000000000103
Family GalR/LacI-like bacterial regulator 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|145599173|ref|YP_001163249.1|
Sequence length 346
Comment LacI family transcriptional regulator [Yersinia pestis Pestoides F]
Sequence
MTTGKKRETLKTIAETLNVTHTTVSNVFNRPEKVSPELREKILAYAESINYHGPAGAGRF
LRTGKCGTLGVIFNDNLSYVFSDRHDIALMRGIAEECEKNGINIALMPLKTNNALKKRMM
GALVDGYILNATYNNDEVVQAALTSGLPVITTDIKLQNFTCVSIDDGAAMQAICHHLLAA
GHKKFGIVSFPVKRLPGELTSLAEFSTDYDNGVAFGRISACITALSDAGIDLHTSYVAEQ
PHSETGGEKAAKALLAKEPGISAIICLSDRFAFGVYQFCQDHNIPVPGQIAITGFDDIDI
QDPPVGLTTIRQPTVLKGREAARALISGQLDNDISLDFELVVRDSA
Download sequence
Identical sequences A0A0E1NUT3 A0A0H2YJH7 A0A0H3B2V7 A0A0M1V9C3 A0A0U1EU15 A0A0U1QVG6 A0A208S8L3 A0A2A7VGU6 Q0WE46 Q669G6 Q7CJ48
gi|108812234|ref|YP_648001.1| gi|162420774|ref|YP_001606229.1| gi|145599173|ref|YP_001163249.1| gi|294504236|ref|YP_003568298.1| gi|153947536|ref|YP_001400504.1| gi|186895918|ref|YP_001873030.1| gi|218929567|ref|YP_002347442.1| gi|384122757|ref|YP_005505377.1| gi|170023874|ref|YP_001720379.1| NYSGXRC-11235a gi|45442087|ref|NP_993626.1| gi|22125605|ref|NP_669028.1| gi|384126673|ref|YP_005509287.1| gi|108807969|ref|YP_651885.1| gi|384139697|ref|YP_005522399.1| WP_002210200.1.100246 WP_002210200.1.10066 WP_002210200.1.100921 WP_002210200.1.100931 WP_002210200.1.10105 WP_002210200.1.101305 WP_002210200.1.101382 WP_002210200.1.101928 WP_002210200.1.102067 WP_002210200.1.10736 WP_002210200.1.10935 WP_002210200.1.10955 WP_002210200.1.11693 WP_002210200.1.12167 WP_002210200.1.12463 WP_002210200.1.12736 WP_002210200.1.12857 WP_002210200.1.1388 WP_002210200.1.14063 WP_002210200.1.14169 WP_002210200.1.14804 WP_002210200.1.15321 WP_002210200.1.15555 WP_002210200.1.15605 WP_002210200.1.15689 WP_002210200.1.16243 WP_002210200.1.16333 WP_002210200.1.17135 WP_002210200.1.17141 WP_002210200.1.17608 WP_002210200.1.17873 WP_002210200.1.17983 WP_002210200.1.18208 WP_002210200.1.18640 WP_002210200.1.18826 WP_002210200.1.19329 WP_002210200.1.19425 WP_002210200.1.19739 WP_002210200.1.19763 WP_002210200.1.20035 WP_002210200.1.20380 WP_002210200.1.20547 WP_002210200.1.2064 WP_002210200.1.20932 WP_002210200.1.21486 WP_002210200.1.21784 WP_002210200.1.21879 WP_002210200.1.21934 WP_002210200.1.22542 WP_002210200.1.22708 WP_002210200.1.23157 WP_002210200.1.23271 WP_002210200.1.23687 WP_002210200.1.23811 WP_002210200.1.24002 WP_002210200.1.2451 WP_002210200.1.24517 WP_002210200.1.25181 WP_002210200.1.25394 WP_002210200.1.26383 WP_002210200.1.2640 WP_002210200.1.26960 WP_002210200.1.27124 WP_002210200.1.27251 WP_002210200.1.2726 WP_002210200.1.28647 WP_002210200.1.28922 WP_002210200.1.29157 WP_002210200.1.29355 WP_002210200.1.2947 WP_002210200.1.29622 WP_002210200.1.2964 WP_002210200.1.29685 WP_002210200.1.29814 WP_002210200.1.3092 WP_002210200.1.30931 WP_002210200.1.311 WP_002210200.1.31496 WP_002210200.1.31739 WP_002210200.1.31805 WP_002210200.1.32343 WP_002210200.1.32388 WP_002210200.1.32446 WP_002210200.1.32736 WP_002210200.1.33203 WP_002210200.1.33324 WP_002210200.1.33661 WP_002210200.1.33937 WP_002210200.1.34031 WP_002210200.1.34138 WP_002210200.1.35389 WP_002210200.1.35538 WP_002210200.1.36088 WP_002210200.1.37174 WP_002210200.1.37494 WP_002210200.1.37863 WP_002210200.1.38147 WP_002210200.1.38235 WP_002210200.1.38532 WP_002210200.1.38743 WP_002210200.1.38824 WP_002210200.1.38993 WP_002210200.1.39066 WP_002210200.1.39346 WP_002210200.1.3976 WP_002210200.1.39858 WP_002210200.1.40071 WP_002210200.1.40134 WP_002210200.1.40853 WP_002210200.1.41196 WP_002210200.1.4210 WP_002210200.1.42361 WP_002210200.1.42490 WP_002210200.1.42976 WP_002210200.1.44408 WP_002210200.1.44598 WP_002210200.1.44603 WP_002210200.1.44832 WP_002210200.1.45198 WP_002210200.1.45214 WP_002210200.1.46262 WP_002210200.1.46545 WP_002210200.1.46686 WP_002210200.1.46731 WP_002210200.1.4678 WP_002210200.1.46891 WP_002210200.1.47387 WP_002210200.1.47769 WP_002210200.1.47881 WP_002210200.1.48166 WP_002210200.1.48722 WP_002210200.1.4889 WP_002210200.1.49315 WP_002210200.1.49906 WP_002210200.1.4997 WP_002210200.1.50010 WP_002210200.1.50093 WP_002210200.1.50106 WP_002210200.1.50185 WP_002210200.1.50984 WP_002210200.1.51284 WP_002210200.1.51293 WP_002210200.1.51588 WP_002210200.1.51772 WP_002210200.1.51934 WP_002210200.1.52158 WP_002210200.1.52247 WP_002210200.1.52473 WP_002210200.1.52734 WP_002210200.1.52792 WP_002210200.1.52819 WP_002210200.1.52969 WP_002210200.1.53147 WP_002210200.1.53300 WP_002210200.1.53838 WP_002210200.1.53848 WP_002210200.1.53883 WP_002210200.1.53953 WP_002210200.1.54568 WP_002210200.1.54951 WP_002210200.1.55194 WP_002210200.1.55695 WP_002210200.1.5592 WP_002210200.1.56031 WP_002210200.1.56912 WP_002210200.1.56953 WP_002210200.1.57585 WP_002210200.1.57657 WP_002210200.1.58067 WP_002210200.1.58543 WP_002210200.1.58794 WP_002210200.1.59102 WP_002210200.1.59431 WP_002210200.1.5957 WP_002210200.1.59635 WP_002210200.1.59687 WP_002210200.1.59789 WP_002210200.1.59885 WP_002210200.1.60437 WP_002210200.1.60707 WP_002210200.1.60896 WP_002210200.1.61689 WP_002210200.1.62232 WP_002210200.1.62342 WP_002210200.1.6270 WP_002210200.1.6333 WP_002210200.1.63387 WP_002210200.1.63641 WP_002210200.1.64142 WP_002210200.1.64474 WP_002210200.1.64780 WP_002210200.1.64786 WP_002210200.1.64910 WP_002210200.1.653 WP_002210200.1.65554 WP_002210200.1.6570 WP_002210200.1.65706 WP_002210200.1.65718 WP_002210200.1.6581 WP_002210200.1.66118 WP_002210200.1.66546 WP_002210200.1.66616 WP_002210200.1.67404 WP_002210200.1.67850 WP_002210200.1.6791 WP_002210200.1.68361 WP_002210200.1.68371 WP_002210200.1.68753 WP_002210200.1.68855 WP_002210200.1.69018 WP_002210200.1.69316 WP_002210200.1.69951 WP_002210200.1.70117 WP_002210200.1.70171 WP_002210200.1.70377 WP_002210200.1.70417 WP_002210200.1.70726 WP_002210200.1.7083 WP_002210200.1.7169 WP_002210200.1.71744 WP_002210200.1.72280 WP_002210200.1.72440 WP_002210200.1.72486 WP_002210200.1.7402 WP_002210200.1.74131 WP_002210200.1.74310 WP_002210200.1.74577 WP_002210200.1.74738 WP_002210200.1.75173 WP_002210200.1.7518 WP_002210200.1.75208 WP_002210200.1.75407 WP_002210200.1.75636 WP_002210200.1.75689 WP_002210200.1.75821 WP_002210200.1.76555 WP_002210200.1.76670 WP_002210200.1.77387 WP_002210200.1.77429 WP_002210200.1.77691 WP_002210200.1.78004 WP_002210200.1.7841 WP_002210200.1.78556 WP_002210200.1.79515 WP_002210200.1.79550 WP_002210200.1.79981 WP_002210200.1.8009 WP_002210200.1.80331 WP_002210200.1.81848 WP_002210200.1.81877 WP_002210200.1.8210 WP_002210200.1.82133 WP_002210200.1.82151 WP_002210200.1.82270 WP_002210200.1.82436 WP_002210200.1.82619 WP_002210200.1.8303 WP_002210200.1.83265 WP_002210200.1.83630 WP_002210200.1.8420 WP_002210200.1.84703 WP_002210200.1.84720 WP_002210200.1.85269 WP_002210200.1.85270 WP_002210200.1.8559 WP_002210200.1.85802 WP_002210200.1.86034 WP_002210200.1.86059 WP_002210200.1.86413 WP_002210200.1.87107 WP_002210200.1.8728 WP_002210200.1.87418 WP_002210200.1.8762 WP_002210200.1.87853 WP_002210200.1.87988 WP_002210200.1.88472 WP_002210200.1.89359 WP_002210200.1.8964 WP_002210200.1.90176 WP_002210200.1.9051 WP_002210200.1.90624 WP_002210200.1.91263 WP_002210200.1.91373 WP_002210200.1.91844 WP_002210200.1.92030 WP_002210200.1.92331 WP_002210200.1.92604 WP_002210200.1.927 WP_002210200.1.9311 WP_002210200.1.9320 WP_002210200.1.93623 WP_002210200.1.93928 WP_002210200.1.93933 WP_002210200.1.94052 WP_002210200.1.94201 WP_002210200.1.94545 WP_002210200.1.94683 WP_002210200.1.95746 WP_002210200.1.95981 WP_002210200.1.97245 WP_002210200.1.97375 WP_002210200.1.97448 WP_002210200.1.97791 WP_002210200.1.97864 WP_002210200.1.97894 WP_002210200.1.99109 WP_002210200.1.99383 WP_002210200.1.9941 WP_002210200.1.99416 WP_002210200.1.99788 WP_002210200.1.99882 WP_002210200.1.99990 YP_002347442.1.25044 187410.y1711 214092.YPO2478 229193.YP_2297 273123.YPTB2519 349746.YpAngola_A1737 349747.YpsIP31758_1526 360102.YPA_1974 377628.YPN_2072 386656.YPDSF_1891 502800.YPK_1633 502801.YPTS_2613 gi|51596840|ref|YP_071031.1| gi|384414189|ref|YP_005623551.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]