SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145599191|ref|YP_001163267.1| from Yersinia pestis Pestoides F

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145599191|ref|YP_001163267.1|
Domain Number 1 Region: 65-319
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.71e-39
Family L-arabinose binding protein-like 0.00038
Further Details:      
 
Domain Number 2 Region: 7-65
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 1.97e-16
Family GalR/LacI-like bacterial regulator 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|145599191|ref|YP_001163267.1|
Sequence length 334
Comment LacI family transcriptional regulator [Yersinia pestis Pestoides F]
Sequence
MSKAYSNATIVDIARRANVTNITVSRTFNQPGLVKQETREKIHAIAKELNYVPNAFAQGL
KRSSSQIIGIVTSSMYNPFYSELIQTVSRIARTQCYQIMLFDTDGSEEAEMEAIQALFGY
KACGILLSPVRDDKNYQPAYLDLAETYRVPLILIDRDIYNRQLSGVFLNNKEIGLLAGKY
LSEQPERKMLIIGGPAESEITRVRIEGIINALENKKNDVHIINGDYDFISQEAAVRDYLS
VPQNQPDYIIGLNGILTLGAIAICHELKIYNNIKFFSIDEPPKAADYGLHIAGVYHDTQM
LGEIAAELLFNAIKKPHNDQAVRREFFTGSLLTH
Download sequence
Identical sequences A0A0E1NMV8 A0A0H2YJJ6 A0A0M1V8J7 A0A208S8F8 Q0WE26 Q7CJ56
gi|384139676|ref|YP_005522378.1| 187410.y1690 214092.YPO2498 229193.YP_2313 349746.YpAngola_A1758 360102.YPA_1993 377628.YPN_2092 386656.YPDSF_1909 gi|384414168|ref|YP_005623530.1| WP_002210220.1.100083 WP_002210220.1.100246 WP_002210220.1.100921 WP_002210220.1.10105 WP_002210220.1.101305 WP_002210220.1.101382 WP_002210220.1.101928 WP_002210220.1.102067 WP_002210220.1.10736 WP_002210220.1.10935 WP_002210220.1.10955 WP_002210220.1.11693 WP_002210220.1.12463 WP_002210220.1.12736 WP_002210220.1.12857 WP_002210220.1.1388 WP_002210220.1.14063 WP_002210220.1.14804 WP_002210220.1.15321 WP_002210220.1.15555 WP_002210220.1.15605 WP_002210220.1.15689 WP_002210220.1.16243 WP_002210220.1.16333 WP_002210220.1.17135 WP_002210220.1.17141 WP_002210220.1.17608 WP_002210220.1.17873 WP_002210220.1.17983 WP_002210220.1.18208 WP_002210220.1.18640 WP_002210220.1.18826 WP_002210220.1.19739 WP_002210220.1.19763 WP_002210220.1.2064 WP_002210220.1.21784 WP_002210220.1.21879 WP_002210220.1.21934 WP_002210220.1.22542 WP_002210220.1.23157 WP_002210220.1.23271 WP_002210220.1.23687 WP_002210220.1.23811 WP_002210220.1.24002 WP_002210220.1.2451 WP_002210220.1.25181 WP_002210220.1.25394 WP_002210220.1.2640 WP_002210220.1.26960 WP_002210220.1.27124 WP_002210220.1.27251 WP_002210220.1.2726 WP_002210220.1.28647 WP_002210220.1.29157 WP_002210220.1.29355 WP_002210220.1.2947 WP_002210220.1.29622 WP_002210220.1.29685 WP_002210220.1.29814 WP_002210220.1.3092 WP_002210220.1.30931 WP_002210220.1.311 WP_002210220.1.31336 WP_002210220.1.31496 WP_002210220.1.31739 WP_002210220.1.31805 WP_002210220.1.32343 WP_002210220.1.32446 WP_002210220.1.33203 WP_002210220.1.33937 WP_002210220.1.34031 WP_002210220.1.34138 WP_002210220.1.35389 WP_002210220.1.35538 WP_002210220.1.36088 WP_002210220.1.37174 WP_002210220.1.37494 WP_002210220.1.37863 WP_002210220.1.38235 WP_002210220.1.38824 WP_002210220.1.38993 WP_002210220.1.39066 WP_002210220.1.3976 WP_002210220.1.40071 WP_002210220.1.40134 WP_002210220.1.40534 WP_002210220.1.40853 WP_002210220.1.41196 WP_002210220.1.4210 WP_002210220.1.42490 WP_002210220.1.44408 WP_002210220.1.44832 WP_002210220.1.45198 WP_002210220.1.45214 WP_002210220.1.46262 WP_002210220.1.46545 WP_002210220.1.46686 WP_002210220.1.46731 WP_002210220.1.4678 WP_002210220.1.46891 WP_002210220.1.47387 WP_002210220.1.47440 WP_002210220.1.48722 WP_002210220.1.50010 WP_002210220.1.50093 WP_002210220.1.50984 WP_002210220.1.51284 WP_002210220.1.51293 WP_002210220.1.51588 WP_002210220.1.51772 WP_002210220.1.51934 WP_002210220.1.52158 WP_002210220.1.52247 WP_002210220.1.52734 WP_002210220.1.52819 WP_002210220.1.53838 WP_002210220.1.53848 WP_002210220.1.53953 WP_002210220.1.54568 WP_002210220.1.54951 WP_002210220.1.55194 WP_002210220.1.5592 WP_002210220.1.56031 WP_002210220.1.56912 WP_002210220.1.57585 WP_002210220.1.57657 WP_002210220.1.58067 WP_002210220.1.58794 WP_002210220.1.59102 WP_002210220.1.59431 WP_002210220.1.5957 WP_002210220.1.59635 WP_002210220.1.59789 WP_002210220.1.59885 WP_002210220.1.60437 WP_002210220.1.60707 WP_002210220.1.60896 WP_002210220.1.62232 WP_002210220.1.62342 WP_002210220.1.6270 WP_002210220.1.64142 WP_002210220.1.64474 WP_002210220.1.64780 WP_002210220.1.64910 WP_002210220.1.653 WP_002210220.1.65554 WP_002210220.1.6570 WP_002210220.1.65706 WP_002210220.1.65718 WP_002210220.1.6581 WP_002210220.1.66118 WP_002210220.1.66546 WP_002210220.1.66616 WP_002210220.1.67404 WP_002210220.1.67850 WP_002210220.1.68361 WP_002210220.1.68753 WP_002210220.1.69018 WP_002210220.1.69316 WP_002210220.1.69951 WP_002210220.1.70117 WP_002210220.1.70171 WP_002210220.1.70319 WP_002210220.1.70377 WP_002210220.1.70417 WP_002210220.1.70726 WP_002210220.1.7083 WP_002210220.1.7169 WP_002210220.1.71744 WP_002210220.1.72280 WP_002210220.1.72440 WP_002210220.1.72486 WP_002210220.1.7402 WP_002210220.1.74131 WP_002210220.1.74310 WP_002210220.1.74577 WP_002210220.1.7518 WP_002210220.1.75337 WP_002210220.1.75636 WP_002210220.1.75689 WP_002210220.1.76670 WP_002210220.1.77387 WP_002210220.1.77429 WP_002210220.1.77691 WP_002210220.1.7841 WP_002210220.1.78556 WP_002210220.1.79550 WP_002210220.1.79981 WP_002210220.1.8009 WP_002210220.1.80331 WP_002210220.1.81877 WP_002210220.1.8210 WP_002210220.1.82133 WP_002210220.1.82151 WP_002210220.1.82270 WP_002210220.1.82619 WP_002210220.1.8303 WP_002210220.1.83039 WP_002210220.1.83265 WP_002210220.1.8420 WP_002210220.1.84703 WP_002210220.1.84720 WP_002210220.1.85269 WP_002210220.1.85270 WP_002210220.1.8559 WP_002210220.1.85802 WP_002210220.1.86034 WP_002210220.1.86413 WP_002210220.1.8728 WP_002210220.1.87418 WP_002210220.1.8762 WP_002210220.1.87853 WP_002210220.1.87988 WP_002210220.1.88362 WP_002210220.1.88472 WP_002210220.1.89359 WP_002210220.1.8964 WP_002210220.1.90176 WP_002210220.1.9051 WP_002210220.1.90624 WP_002210220.1.91373 WP_002210220.1.91844 WP_002210220.1.92030 WP_002210220.1.92331 WP_002210220.1.92604 WP_002210220.1.927 WP_002210220.1.9311 WP_002210220.1.9320 WP_002210220.1.93623 WP_002210220.1.93928 WP_002210220.1.94052 WP_002210220.1.94201 WP_002210220.1.94545 WP_002210220.1.94683 WP_002210220.1.95981 WP_002210220.1.97245 WP_002210220.1.97375 WP_002210220.1.97448 WP_002210220.1.97791 WP_002210220.1.97864 WP_002210220.1.97894 WP_002210220.1.99109 WP_002210220.1.99383 WP_002210220.1.9941 WP_002210220.1.99416 WP_002210220.1.99788 WP_002210220.1.99990 YP_002347462.1.25044 gi|218929587|ref|YP_002347462.1| gi|108807988|ref|YP_651904.1| gi|45442103|ref|NP_993642.1| gi|162420844|ref|YP_001606247.1| gi|384126660|ref|YP_005509274.1| gi|384122773|ref|YP_005505393.1| gi|108812254|ref|YP_648021.1| gi|145599191|ref|YP_001163267.1| gi|22125585|ref|NP_669008.1| gi|294504250|ref|YP_003568312.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]