SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145599227|ref|YP_001163303.1| from Yersinia pestis Pestoides F

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145599227|ref|YP_001163303.1|
Domain Number 1 Region: 62-317
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.81e-51
Family L-arabinose binding protein-like 0.0000687
Further Details:      
 
Domain Number 2 Region: 4-53
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000000731
Family GalR/LacI-like bacterial regulator 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|145599227|ref|YP_001163303.1|
Sequence length 330
Comment LacI family transcriptional regulator [Yersinia pestis Pestoides F]
Sequence
MKNQRVTLQDIALLAGVTKMTVSRYLRMPEKVAPETGERIAQVMAEVNYSADPESETSLN
QKSPRIGILVPSFNNQIFSDLLAGIESITVANGYQTLVVNYNYNKAREEEQIINLLSCQI
SGLILTDSEHTLRADKYLNAAEIPIAQVMELEPQENRITVGFNNYQAAYDMTTTLLASGK
QHIVYFGSMSDARDRKRYQGYSQAVTDAGFTPLHITPNKVSSVSIGAGMLALARQMYPDV
DAIFCTNDDMAVGVLQECLKLGVAIPAEMAISGFHGLDIGQATTPILASVTTPRFEMGKV
AAEILIKKIKKIPTIEQVDLHYRISLGGTI
Download sequence
Identical sequences A0A0E1NT61 A0A0H2YJX4 A0A0M1V8U4 A0A208S4L2 A0A2A7VGW4 Q0WDZ0 Q7CJ81
gi|294504351|ref|YP_003568413.1| gi|384139634|ref|YP_005522336.1| gi|218929623|ref|YP_002347498.1| gi|108808024|ref|YP_651940.1| gi|45442137|ref|NP_993676.1| gi|22125545|ref|NP_668968.1| gi|162419472|ref|YP_001606285.1| WP_002210260.1.100083 WP_002210260.1.100246 WP_002210260.1.100921 WP_002210260.1.100931 WP_002210260.1.10105 WP_002210260.1.101305 WP_002210260.1.101382 WP_002210260.1.101928 WP_002210260.1.102012 WP_002210260.1.10736 WP_002210260.1.10935 WP_002210260.1.10955 WP_002210260.1.11693 WP_002210260.1.12463 WP_002210260.1.12736 WP_002210260.1.12857 WP_002210260.1.1388 WP_002210260.1.14063 WP_002210260.1.15321 WP_002210260.1.15555 WP_002210260.1.15605 WP_002210260.1.16243 WP_002210260.1.16333 WP_002210260.1.17135 WP_002210260.1.17141 WP_002210260.1.17608 WP_002210260.1.17873 WP_002210260.1.17983 WP_002210260.1.18640 WP_002210260.1.18826 WP_002210260.1.19425 WP_002210260.1.19739 WP_002210260.1.19763 WP_002210260.1.20035 WP_002210260.1.20547 WP_002210260.1.2064 WP_002210260.1.21486 WP_002210260.1.21784 WP_002210260.1.21879 WP_002210260.1.21934 WP_002210260.1.22708 WP_002210260.1.23157 WP_002210260.1.23271 WP_002210260.1.23687 WP_002210260.1.23811 WP_002210260.1.24002 WP_002210260.1.2451 WP_002210260.1.25181 WP_002210260.1.25394 WP_002210260.1.2640 WP_002210260.1.26776 WP_002210260.1.26960 WP_002210260.1.27124 WP_002210260.1.27251 WP_002210260.1.2726 WP_002210260.1.28647 WP_002210260.1.28922 WP_002210260.1.29157 WP_002210260.1.29355 WP_002210260.1.29622 WP_002210260.1.2964 WP_002210260.1.29685 WP_002210260.1.29814 WP_002210260.1.3092 WP_002210260.1.30931 WP_002210260.1.311 WP_002210260.1.31336 WP_002210260.1.31496 WP_002210260.1.31739 WP_002210260.1.32343 WP_002210260.1.32388 WP_002210260.1.32446 WP_002210260.1.33203 WP_002210260.1.33661 WP_002210260.1.33937 WP_002210260.1.34031 WP_002210260.1.34138 WP_002210260.1.35389 WP_002210260.1.35538 WP_002210260.1.36088 WP_002210260.1.37174 WP_002210260.1.37494 WP_002210260.1.37863 WP_002210260.1.38147 WP_002210260.1.38235 WP_002210260.1.38743 WP_002210260.1.38824 WP_002210260.1.38993 WP_002210260.1.39066 WP_002210260.1.39346 WP_002210260.1.40134 WP_002210260.1.40853 WP_002210260.1.41196 WP_002210260.1.4210 WP_002210260.1.42490 WP_002210260.1.42976 WP_002210260.1.44408 WP_002210260.1.44598 WP_002210260.1.44603 WP_002210260.1.44832 WP_002210260.1.45198 WP_002210260.1.45214 WP_002210260.1.46262 WP_002210260.1.46545 WP_002210260.1.46686 WP_002210260.1.46731 WP_002210260.1.4678 WP_002210260.1.46891 WP_002210260.1.47387 WP_002210260.1.47440 WP_002210260.1.48166 WP_002210260.1.48722 WP_002210260.1.4889 WP_002210260.1.49315 WP_002210260.1.49906 WP_002210260.1.4997 WP_002210260.1.50010 WP_002210260.1.50093 WP_002210260.1.50106 WP_002210260.1.50984 WP_002210260.1.51284 WP_002210260.1.51293 WP_002210260.1.51588 WP_002210260.1.51772 WP_002210260.1.51934 WP_002210260.1.52158 WP_002210260.1.52247 WP_002210260.1.52734 WP_002210260.1.52819 WP_002210260.1.52969 WP_002210260.1.53300 WP_002210260.1.53838 WP_002210260.1.53953 WP_002210260.1.54568 WP_002210260.1.54951 WP_002210260.1.55194 WP_002210260.1.55695 WP_002210260.1.5592 WP_002210260.1.56912 WP_002210260.1.56953 WP_002210260.1.57585 WP_002210260.1.57657 WP_002210260.1.58067 WP_002210260.1.58794 WP_002210260.1.59102 WP_002210260.1.59431 WP_002210260.1.5957 WP_002210260.1.59635 WP_002210260.1.59687 WP_002210260.1.59789 WP_002210260.1.60437 WP_002210260.1.60707 WP_002210260.1.61689 WP_002210260.1.62342 WP_002210260.1.6270 WP_002210260.1.63387 WP_002210260.1.64142 WP_002210260.1.64474 WP_002210260.1.64780 WP_002210260.1.64786 WP_002210260.1.64910 WP_002210260.1.653 WP_002210260.1.65400 WP_002210260.1.65554 WP_002210260.1.6570 WP_002210260.1.65706 WP_002210260.1.65718 WP_002210260.1.6581 WP_002210260.1.66118 WP_002210260.1.66616 WP_002210260.1.67404 WP_002210260.1.67850 WP_002210260.1.68361 WP_002210260.1.68753 WP_002210260.1.68855 WP_002210260.1.69018 WP_002210260.1.69316 WP_002210260.1.69951 WP_002210260.1.70171 WP_002210260.1.70319 WP_002210260.1.70377 WP_002210260.1.70417 WP_002210260.1.70726 WP_002210260.1.7083 WP_002210260.1.7169 WP_002210260.1.71744 WP_002210260.1.72280 WP_002210260.1.72440 WP_002210260.1.72486 WP_002210260.1.7402 WP_002210260.1.74310 WP_002210260.1.74577 WP_002210260.1.7518 WP_002210260.1.75337 WP_002210260.1.75407 WP_002210260.1.75636 WP_002210260.1.75689 WP_002210260.1.75821 WP_002210260.1.77387 WP_002210260.1.77429 WP_002210260.1.77691 WP_002210260.1.78004 WP_002210260.1.7841 WP_002210260.1.78556 WP_002210260.1.79515 WP_002210260.1.79550 WP_002210260.1.79609 WP_002210260.1.79981 WP_002210260.1.8009 WP_002210260.1.80331 WP_002210260.1.81848 WP_002210260.1.81877 WP_002210260.1.8210 WP_002210260.1.82133 WP_002210260.1.82151 WP_002210260.1.82270 WP_002210260.1.82619 WP_002210260.1.8303 WP_002210260.1.83039 WP_002210260.1.83265 WP_002210260.1.8420 WP_002210260.1.84703 WP_002210260.1.84720 WP_002210260.1.85269 WP_002210260.1.85270 WP_002210260.1.8559 WP_002210260.1.85802 WP_002210260.1.86034 WP_002210260.1.87107 WP_002210260.1.8728 WP_002210260.1.87418 WP_002210260.1.8762 WP_002210260.1.87853 WP_002210260.1.87988 WP_002210260.1.88362 WP_002210260.1.88472 WP_002210260.1.89359 WP_002210260.1.8964 WP_002210260.1.9051 WP_002210260.1.90624 WP_002210260.1.91373 WP_002210260.1.91844 WP_002210260.1.92030 WP_002210260.1.92331 WP_002210260.1.92604 WP_002210260.1.927 WP_002210260.1.9311 WP_002210260.1.9320 WP_002210260.1.93623 WP_002210260.1.93928 WP_002210260.1.93933 WP_002210260.1.94052 WP_002210260.1.94201 WP_002210260.1.94683 WP_002210260.1.95746 WP_002210260.1.95981 WP_002210260.1.97245 WP_002210260.1.97375 WP_002210260.1.97448 WP_002210260.1.97791 WP_002210260.1.97872 WP_002210260.1.97894 WP_002210260.1.99109 WP_002210260.1.99383 WP_002210260.1.9941 WP_002210260.1.99416 WP_002210260.1.99990 YP_002347498.1.25044 gi|145599227|ref|YP_001163303.1| 187410.y1650 214092.YPO2537 229193.YP_2348 349746.YpAngola_A1796 360102.YPA_2029 377628.YPN_2132 386656.YPDSF_1947 gi|384414123|ref|YP_005623485.1| gi|108812294|ref|YP_648061.1| gi|384126625|ref|YP_005509239.1| gi|384123064|ref|YP_005505684.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]