SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145599255|ref|YP_001163331.1| from Yersinia pestis Pestoides F

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145599255|ref|YP_001163331.1|
Domain Number 1 Region: 70-324
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.12e-42
Family L-arabinose binding protein-like 0.0005
Further Details:      
 
Domain Number 2 Region: 12-70
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 1.35e-16
Family GalR/LacI-like bacterial regulator 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|145599255|ref|YP_001163331.1|
Sequence length 344
Comment LacI family transcriptional regulator [Yersinia pestis Pestoides F]
Sequence
MEKIRKRRNTGRVTLQEVADYAGVGSMTVSRALRTPEQVSDKLREKIEQAVEKLGYIPNR
AAGALASGHSDTVAVLIPSLTDKASSRFMQALQQILNKNEFQLLLGCHEYNQRKEAEILM
TLLQSHPAAVVIFGSQLADKTYQILERTNIPIVNVVGSYFKGAKITLEAAFFESAYELTR
HLLERGYQHIGYLGAHRDNQLQRQQLNGWHKSMLEHYKNADQTVTTPDAASLQFGRYALT
EILLRQPELDAVICSHEDIALGVLFECQRRLLKIPSGIAVACLDGSESCDQTHPTLTSMR
IDYKKMGKEAGKMLIDMLNEDDAGVKSVPLSQSFNYKFEPRQST
Download sequence
Identical sequences A0A0E1NT15 A0A0H2YJP3 A0A0H3B1R0 A0A208S531 Q0WDV9
gi|384414086|ref|YP_005623448.1| 214092.YPO2568 360102.YPA_2057 377628.YPN_2160 386656.YPDSF_1975 502800.YPK_1549 gi|145599255|ref|YP_001163331.1| WP_002216059.1.100083 WP_002216059.1.100246 WP_002216059.1.100593 WP_002216059.1.10066 WP_002216059.1.100921 WP_002216059.1.100931 WP_002216059.1.10105 WP_002216059.1.101305 WP_002216059.1.101382 WP_002216059.1.101928 WP_002216059.1.102012 WP_002216059.1.102067 WP_002216059.1.10736 WP_002216059.1.10935 WP_002216059.1.10955 WP_002216059.1.11693 WP_002216059.1.12463 WP_002216059.1.12736 WP_002216059.1.12857 WP_002216059.1.1388 WP_002216059.1.14063 WP_002216059.1.14804 WP_002216059.1.15321 WP_002216059.1.15555 WP_002216059.1.15605 WP_002216059.1.15689 WP_002216059.1.16243 WP_002216059.1.16333 WP_002216059.1.17135 WP_002216059.1.17141 WP_002216059.1.17608 WP_002216059.1.17873 WP_002216059.1.17983 WP_002216059.1.18208 WP_002216059.1.18640 WP_002216059.1.18826 WP_002216059.1.19329 WP_002216059.1.19425 WP_002216059.1.19739 WP_002216059.1.2064 WP_002216059.1.21486 WP_002216059.1.21784 WP_002216059.1.21879 WP_002216059.1.21934 WP_002216059.1.22530 WP_002216059.1.22708 WP_002216059.1.23157 WP_002216059.1.23271 WP_002216059.1.23687 WP_002216059.1.23811 WP_002216059.1.24002 WP_002216059.1.2451 WP_002216059.1.24517 WP_002216059.1.25181 WP_002216059.1.25394 WP_002216059.1.2640 WP_002216059.1.26776 WP_002216059.1.26960 WP_002216059.1.27124 WP_002216059.1.27251 WP_002216059.1.2726 WP_002216059.1.28647 WP_002216059.1.28922 WP_002216059.1.29157 WP_002216059.1.29186 WP_002216059.1.29355 WP_002216059.1.2947 WP_002216059.1.29622 WP_002216059.1.2964 WP_002216059.1.29685 WP_002216059.1.29814 WP_002216059.1.3092 WP_002216059.1.30931 WP_002216059.1.311 WP_002216059.1.31336 WP_002216059.1.31496 WP_002216059.1.31721 WP_002216059.1.31739 WP_002216059.1.31805 WP_002216059.1.32343 WP_002216059.1.32446 WP_002216059.1.33203 WP_002216059.1.33661 WP_002216059.1.33775 WP_002216059.1.33937 WP_002216059.1.34031 WP_002216059.1.34138 WP_002216059.1.35389 WP_002216059.1.35538 WP_002216059.1.36088 WP_002216059.1.37174 WP_002216059.1.37494 WP_002216059.1.37863 WP_002216059.1.38147 WP_002216059.1.38235 WP_002216059.1.38743 WP_002216059.1.38824 WP_002216059.1.38993 WP_002216059.1.39066 WP_002216059.1.39346 WP_002216059.1.3976 WP_002216059.1.40071 WP_002216059.1.40134 WP_002216059.1.40534 WP_002216059.1.40853 WP_002216059.1.41196 WP_002216059.1.4210 WP_002216059.1.42490 WP_002216059.1.44408 WP_002216059.1.44598 WP_002216059.1.44603 WP_002216059.1.45198 WP_002216059.1.45214 WP_002216059.1.46262 WP_002216059.1.46545 WP_002216059.1.46686 WP_002216059.1.46731 WP_002216059.1.4678 WP_002216059.1.46891 WP_002216059.1.47387 WP_002216059.1.47440 WP_002216059.1.47881 WP_002216059.1.48166 WP_002216059.1.48722 WP_002216059.1.4889 WP_002216059.1.49906 WP_002216059.1.4997 WP_002216059.1.50010 WP_002216059.1.50093 WP_002216059.1.50984 WP_002216059.1.51284 WP_002216059.1.51293 WP_002216059.1.51588 WP_002216059.1.51772 WP_002216059.1.51934 WP_002216059.1.52158 WP_002216059.1.52247 WP_002216059.1.52734 WP_002216059.1.52792 WP_002216059.1.52819 WP_002216059.1.52969 WP_002216059.1.53147 WP_002216059.1.53300 WP_002216059.1.53838 WP_002216059.1.53848 WP_002216059.1.53883 WP_002216059.1.53953 WP_002216059.1.54568 WP_002216059.1.54951 WP_002216059.1.55194 WP_002216059.1.55695 WP_002216059.1.5592 WP_002216059.1.56031 WP_002216059.1.56912 WP_002216059.1.56953 WP_002216059.1.57585 WP_002216059.1.57657 WP_002216059.1.58067 WP_002216059.1.58794 WP_002216059.1.59102 WP_002216059.1.59431 WP_002216059.1.5957 WP_002216059.1.59635 WP_002216059.1.5968 WP_002216059.1.59687 WP_002216059.1.59789 WP_002216059.1.59885 WP_002216059.1.60437 WP_002216059.1.60707 WP_002216059.1.60896 WP_002216059.1.61689 WP_002216059.1.62232 WP_002216059.1.62342 WP_002216059.1.6270 WP_002216059.1.63387 WP_002216059.1.64142 WP_002216059.1.64780 WP_002216059.1.64786 WP_002216059.1.64910 WP_002216059.1.653 WP_002216059.1.65400 WP_002216059.1.65554 WP_002216059.1.6570 WP_002216059.1.65706 WP_002216059.1.65718 WP_002216059.1.6581 WP_002216059.1.66118 WP_002216059.1.66546 WP_002216059.1.66616 WP_002216059.1.67404 WP_002216059.1.67850 WP_002216059.1.6791 WP_002216059.1.68361 WP_002216059.1.68753 WP_002216059.1.68855 WP_002216059.1.69018 WP_002216059.1.69316 WP_002216059.1.69951 WP_002216059.1.70117 WP_002216059.1.70171 WP_002216059.1.70319 WP_002216059.1.70377 WP_002216059.1.70417 WP_002216059.1.70726 WP_002216059.1.7083 WP_002216059.1.71744 WP_002216059.1.72280 WP_002216059.1.72440 WP_002216059.1.72486 WP_002216059.1.7402 WP_002216059.1.74131 WP_002216059.1.74310 WP_002216059.1.74738 WP_002216059.1.75169 WP_002216059.1.75173 WP_002216059.1.7518 WP_002216059.1.75337 WP_002216059.1.75407 WP_002216059.1.75636 WP_002216059.1.75689 WP_002216059.1.75821 WP_002216059.1.76670 WP_002216059.1.77295 WP_002216059.1.77387 WP_002216059.1.77429 WP_002216059.1.77569 WP_002216059.1.77691 WP_002216059.1.78004 WP_002216059.1.7841 WP_002216059.1.78556 WP_002216059.1.79515 WP_002216059.1.79550 WP_002216059.1.79609 WP_002216059.1.79825 WP_002216059.1.79981 WP_002216059.1.8009 WP_002216059.1.80331 WP_002216059.1.81848 WP_002216059.1.81877 WP_002216059.1.8210 WP_002216059.1.82133 WP_002216059.1.82151 WP_002216059.1.82270 WP_002216059.1.82619 WP_002216059.1.8303 WP_002216059.1.83039 WP_002216059.1.83265 WP_002216059.1.8420 WP_002216059.1.84703 WP_002216059.1.84720 WP_002216059.1.85269 WP_002216059.1.85270 WP_002216059.1.8559 WP_002216059.1.85802 WP_002216059.1.86034 WP_002216059.1.86059 WP_002216059.1.86413 WP_002216059.1.87107 WP_002216059.1.8728 WP_002216059.1.87418 WP_002216059.1.8762 WP_002216059.1.87853 WP_002216059.1.87988 WP_002216059.1.88362 WP_002216059.1.88472 WP_002216059.1.89359 WP_002216059.1.89542 WP_002216059.1.8964 WP_002216059.1.90176 WP_002216059.1.90624 WP_002216059.1.91373 WP_002216059.1.91844 WP_002216059.1.92030 WP_002216059.1.92331 WP_002216059.1.92604 WP_002216059.1.9311 WP_002216059.1.9320 WP_002216059.1.93623 WP_002216059.1.93928 WP_002216059.1.93933 WP_002216059.1.94052 WP_002216059.1.94201 WP_002216059.1.94545 WP_002216059.1.94683 WP_002216059.1.95746 WP_002216059.1.95981 WP_002216059.1.97245 WP_002216059.1.97375 WP_002216059.1.97448 WP_002216059.1.97791 WP_002216059.1.97864 WP_002216059.1.97872 WP_002216059.1.97894 WP_002216059.1.99109 WP_002216059.1.99383 WP_002216059.1.9941 WP_002216059.1.99416 WP_002216059.1.99882 WP_002216059.1.99972 WP_002216059.1.99990 YP_002347529.1.25044 gi|108812322|ref|YP_648089.1| gi|108808052|ref|YP_651968.1| gi|384139602|ref|YP_005522304.1| gi|170023790|ref|YP_001720295.1| gi|218929654|ref|YP_002347529.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]