SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145600477|ref|YP_001164553.1| from Yersinia pestis Pestoides F

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145600477|ref|YP_001164553.1|
Domain Number 1 Region: 26-339
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.08e-81
Family L-arabinose binding protein-like 0.0000000000623
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|145600477|ref|YP_001164553.1|
Sequence length 339
Comment periplasmic solute-binding protein [Yersinia pestis Pestoides F]
Sequence
MRTQRLKKLALVCALGFACITTAQAAERIAFIPKLVGVGFFTSGGKGAVDAGKALGVDVT
YDGPTEPSVSGQVQLINNFVNQGYNAIVVSAVSPDGLCPALKRAMQRGVKILTWDSDTKP
ECRSVYINQGTPNQLGSMLVDMAANQVKKEQAKVAFFYSSPTVTDQNQWVNEAKKKIQQE
HPGWEIVTTQFGYNDATKSLQTAEGILKAYADLDAIIAPDANALPAAAQAAENLKRANVA
IVGFSTPNVMRPYVERGTVKEFGLWDVVNQGKISVYVANEMLKKGDLNVGDKIDIPNIGV
VEVSPNRVQGYDYEAKGNGIVLLPQRVIFTKENISKYDF
Download sequence
Identical sequences A0A0E1NX87 A0A0M1VC01 A0A208S8Y6 A4TQL8 A9R0S5 Q1C135 Q1CN18 Q74PW2
gi|45443504|ref|NP_995043.1| gi|384137606|ref|YP_005520308.1| gi|162421765|ref|YP_001605434.1| WP_002209189.1.100083 WP_002209189.1.100246 WP_002209189.1.100921 WP_002209189.1.100931 WP_002209189.1.10105 WP_002209189.1.101305 WP_002209189.1.101382 WP_002209189.1.101928 WP_002209189.1.102012 WP_002209189.1.102067 WP_002209189.1.10736 WP_002209189.1.10935 WP_002209189.1.10955 WP_002209189.1.11693 WP_002209189.1.12463 WP_002209189.1.12736 WP_002209189.1.12857 WP_002209189.1.1388 WP_002209189.1.14063 WP_002209189.1.15321 WP_002209189.1.15555 WP_002209189.1.15605 WP_002209189.1.16243 WP_002209189.1.16333 WP_002209189.1.17135 WP_002209189.1.17141 WP_002209189.1.17608 WP_002209189.1.17873 WP_002209189.1.17983 WP_002209189.1.18208 WP_002209189.1.18640 WP_002209189.1.18826 WP_002209189.1.19329 WP_002209189.1.19425 WP_002209189.1.19739 WP_002209189.1.19763 WP_002209189.1.20035 WP_002209189.1.2064 WP_002209189.1.21486 WP_002209189.1.21784 WP_002209189.1.21879 WP_002209189.1.21934 WP_002209189.1.22530 WP_002209189.1.22542 WP_002209189.1.22708 WP_002209189.1.23157 WP_002209189.1.23271 WP_002209189.1.23687 WP_002209189.1.23811 WP_002209189.1.24002 WP_002209189.1.2451 WP_002209189.1.25181 WP_002209189.1.25394 WP_002209189.1.2640 WP_002209189.1.26776 WP_002209189.1.26960 WP_002209189.1.27124 WP_002209189.1.27251 WP_002209189.1.2726 WP_002209189.1.28647 WP_002209189.1.28922 WP_002209189.1.29157 WP_002209189.1.29355 WP_002209189.1.2947 WP_002209189.1.29622 WP_002209189.1.2964 WP_002209189.1.29685 WP_002209189.1.29814 WP_002209189.1.3092 WP_002209189.1.30931 WP_002209189.1.311 WP_002209189.1.31336 WP_002209189.1.31496 WP_002209189.1.31739 WP_002209189.1.31805 WP_002209189.1.32343 WP_002209189.1.32388 WP_002209189.1.32446 WP_002209189.1.33203 WP_002209189.1.33661 WP_002209189.1.33937 WP_002209189.1.34031 WP_002209189.1.34138 WP_002209189.1.35389 WP_002209189.1.35538 WP_002209189.1.36088 WP_002209189.1.37174 WP_002209189.1.37494 WP_002209189.1.37863 WP_002209189.1.38147 WP_002209189.1.38235 WP_002209189.1.38743 WP_002209189.1.38824 WP_002209189.1.38993 WP_002209189.1.39066 WP_002209189.1.39346 WP_002209189.1.3976 WP_002209189.1.40071 WP_002209189.1.40134 WP_002209189.1.40534 WP_002209189.1.40853 WP_002209189.1.41196 WP_002209189.1.4210 WP_002209189.1.42490 WP_002209189.1.44408 WP_002209189.1.44598 WP_002209189.1.44603 WP_002209189.1.44832 WP_002209189.1.45198 WP_002209189.1.45214 WP_002209189.1.46262 WP_002209189.1.46545 WP_002209189.1.46686 WP_002209189.1.46731 WP_002209189.1.4678 WP_002209189.1.46891 WP_002209189.1.47387 WP_002209189.1.47440 WP_002209189.1.48166 WP_002209189.1.48722 WP_002209189.1.4889 WP_002209189.1.49906 WP_002209189.1.4997 WP_002209189.1.50010 WP_002209189.1.50093 WP_002209189.1.50106 WP_002209189.1.50984 WP_002209189.1.51284 WP_002209189.1.51293 WP_002209189.1.51588 WP_002209189.1.51772 WP_002209189.1.51934 WP_002209189.1.52158 WP_002209189.1.52247 WP_002209189.1.52734 WP_002209189.1.52819 WP_002209189.1.52969 WP_002209189.1.53838 WP_002209189.1.53848 WP_002209189.1.53953 WP_002209189.1.54568 WP_002209189.1.54951 WP_002209189.1.55194 WP_002209189.1.55695 WP_002209189.1.5592 WP_002209189.1.56912 WP_002209189.1.56953 WP_002209189.1.57585 WP_002209189.1.57657 WP_002209189.1.58067 WP_002209189.1.58794 WP_002209189.1.59102 WP_002209189.1.59431 WP_002209189.1.5957 WP_002209189.1.59635 WP_002209189.1.59687 WP_002209189.1.59789 WP_002209189.1.59885 WP_002209189.1.60437 WP_002209189.1.60707 WP_002209189.1.61689 WP_002209189.1.62232 WP_002209189.1.62342 WP_002209189.1.6270 WP_002209189.1.63387 WP_002209189.1.64142 WP_002209189.1.64474 WP_002209189.1.64780 WP_002209189.1.64786 WP_002209189.1.64910 WP_002209189.1.653 WP_002209189.1.65400 WP_002209189.1.65554 WP_002209189.1.6570 WP_002209189.1.65706 WP_002209189.1.65718 WP_002209189.1.6581 WP_002209189.1.66118 WP_002209189.1.66546 WP_002209189.1.66616 WP_002209189.1.67404 WP_002209189.1.67850 WP_002209189.1.68361 WP_002209189.1.68753 WP_002209189.1.68855 WP_002209189.1.69018 WP_002209189.1.69316 WP_002209189.1.69951 WP_002209189.1.70171 WP_002209189.1.70319 WP_002209189.1.70377 WP_002209189.1.70417 WP_002209189.1.70726 WP_002209189.1.7083 WP_002209189.1.7169 WP_002209189.1.71744 WP_002209189.1.72280 WP_002209189.1.72440 WP_002209189.1.72486 WP_002209189.1.7402 WP_002209189.1.74131 WP_002209189.1.74310 WP_002209189.1.74738 WP_002209189.1.75173 WP_002209189.1.7518 WP_002209189.1.75337 WP_002209189.1.75407 WP_002209189.1.75636 WP_002209189.1.75689 WP_002209189.1.75821 WP_002209189.1.76670 WP_002209189.1.77387 WP_002209189.1.77429 WP_002209189.1.77691 WP_002209189.1.78004 WP_002209189.1.7841 WP_002209189.1.78556 WP_002209189.1.79515 WP_002209189.1.79550 WP_002209189.1.79609 WP_002209189.1.79981 WP_002209189.1.8009 WP_002209189.1.80331 WP_002209189.1.81848 WP_002209189.1.81877 WP_002209189.1.8210 WP_002209189.1.82133 WP_002209189.1.82151 WP_002209189.1.82270 WP_002209189.1.82619 WP_002209189.1.8303 WP_002209189.1.83039 WP_002209189.1.83265 WP_002209189.1.8420 WP_002209189.1.84703 WP_002209189.1.84720 WP_002209189.1.85269 WP_002209189.1.85270 WP_002209189.1.8559 WP_002209189.1.85802 WP_002209189.1.86034 WP_002209189.1.86413 WP_002209189.1.87107 WP_002209189.1.8728 WP_002209189.1.87418 WP_002209189.1.8762 WP_002209189.1.87853 WP_002209189.1.87988 WP_002209189.1.88362 WP_002209189.1.88472 WP_002209189.1.89359 WP_002209189.1.8964 WP_002209189.1.9051 WP_002209189.1.90624 WP_002209189.1.91373 WP_002209189.1.91844 WP_002209189.1.92030 WP_002209189.1.92331 WP_002209189.1.92604 WP_002209189.1.927 WP_002209189.1.9311 WP_002209189.1.9320 WP_002209189.1.93623 WP_002209189.1.93928 WP_002209189.1.93933 WP_002209189.1.94052 WP_002209189.1.94201 WP_002209189.1.94545 WP_002209189.1.94683 WP_002209189.1.95746 WP_002209189.1.95981 WP_002209189.1.97245 WP_002209189.1.97375 WP_002209189.1.97448 WP_002209189.1.97791 WP_002209189.1.97864 WP_002209189.1.97872 WP_002209189.1.97894 WP_002209189.1.99109 WP_002209189.1.99383 WP_002209189.1.9941 WP_002209189.1.99416 WP_002209189.1.99788 WP_002209189.1.99990 YP_002345486.1.25044 gi|384124824|ref|YP_005507438.1| gi|384416528|ref|YP_005625890.1| gi|145600477|ref|YP_001164553.1| gi|108809866|ref|YP_653782.1| gi|218927611|ref|YP_002345486.1| gi|294502511|ref|YP_003566573.1| gi|384120946|ref|YP_005503566.1| 214092.YPO0409 229193.YP_3772 349746.YpAngola_A0861 360102.YPA_3876 377628.YPN_0279 386656.YPDSF_3222 gi|108810445|ref|YP_646212.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]