SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145600580|ref|YP_001164656.1| from Yersinia pestis Pestoides F

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145600580|ref|YP_001164656.1|
Domain Number 1 Region: 7-308
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.53e-78
Family L-arabinose binding protein-like 0.0000296
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|145600580|ref|YP_001164656.1|
Sequence length 314
Comment sugar-binding transport protein [Yersinia pestis Pestoides F]
Sequence
MRLKPIMTALIAGAMIASSPALQAKELNSIGVTVGDLANPFFVQITKGVELEARKLAGDK
VKVTLVSSGYDLGQQVAQIDNFIAAKVDMIILNAADSKGIGPAVKRAKDAGIVVVAVDVA
AEGADATITSDNTQAGAMACKYISDRLKEKGNVVIINGPPVSAIQNRVEGCESEFKKYPD
IKVLSSNQNAKGSREGGLEVMTSLLAVNPKIDGVFAINDPTAIGADLAAKQAQRNEFFIV
GVDGSPDAEEALKRGGNTLFVATPAQDPQVMASKAVEVGYGILQGNPAPKDPILIPVTLI
DKNNISTYKGWTMK
Download sequence
Identical sequences A0A0E1NNA4 A0A0H2YLS0 A0A0H3B048 A0A0M1VBK1 A0A0U1ETS9 A0A0U1R361 A0A208RWX9 A0A2A7VM15 Q0WA55 Q664G4 Q7CFZ8
gi|145600580|ref|YP_001164656.1| gi|108809781|ref|YP_653697.1| gi|294504312|ref|YP_003568374.1| gi|153950802|ref|YP_001402974.1| 187410.y3867 214092.YPO3962 229193.YP_3325 273123.YPTB3805 349747.YpsIP31758_4028 360102.YPA_3790 377628.YPN_3611 386656.YPDSF_3326 502800.YPK_0127 502801.YPTS_4004 gi|384124071|ref|YP_005506691.1| gi|170022388|ref|YP_001718893.1| gi|186897298|ref|YP_001874410.1| IDP02650 gi|108813771|ref|YP_649538.1| gi|384138187|ref|YP_005520889.1| gi|22127738|ref|NP_671161.1| WP_002209521.1.100083 WP_002209521.1.100246 WP_002209521.1.10066 WP_002209521.1.100921 WP_002209521.1.100931 WP_002209521.1.10105 WP_002209521.1.101305 WP_002209521.1.101382 WP_002209521.1.101928 WP_002209521.1.102012 WP_002209521.1.102067 WP_002209521.1.10736 WP_002209521.1.10935 WP_002209521.1.10955 WP_002209521.1.11693 WP_002209521.1.12167 WP_002209521.1.12463 WP_002209521.1.12736 WP_002209521.1.12857 WP_002209521.1.1388 WP_002209521.1.14063 WP_002209521.1.14169 WP_002209521.1.14804 WP_002209521.1.15321 WP_002209521.1.15555 WP_002209521.1.15605 WP_002209521.1.15689 WP_002209521.1.17135 WP_002209521.1.17141 WP_002209521.1.17608 WP_002209521.1.17873 WP_002209521.1.17983 WP_002209521.1.18208 WP_002209521.1.18640 WP_002209521.1.18826 WP_002209521.1.19329 WP_002209521.1.19425 WP_002209521.1.19739 WP_002209521.1.19763 WP_002209521.1.20035 WP_002209521.1.20380 WP_002209521.1.20547 WP_002209521.1.2064 WP_002209521.1.20932 WP_002209521.1.21486 WP_002209521.1.21784 WP_002209521.1.21879 WP_002209521.1.21934 WP_002209521.1.22542 WP_002209521.1.22708 WP_002209521.1.23271 WP_002209521.1.23687 WP_002209521.1.23811 WP_002209521.1.24002 WP_002209521.1.2451 WP_002209521.1.24517 WP_002209521.1.25181 WP_002209521.1.25394 WP_002209521.1.26383 WP_002209521.1.2640 WP_002209521.1.26776 WP_002209521.1.26960 WP_002209521.1.27124 WP_002209521.1.27251 WP_002209521.1.2726 WP_002209521.1.28647 WP_002209521.1.28922 WP_002209521.1.29157 WP_002209521.1.29186 WP_002209521.1.29355 WP_002209521.1.2947 WP_002209521.1.29622 WP_002209521.1.2964 WP_002209521.1.29685 WP_002209521.1.29814 WP_002209521.1.3092 WP_002209521.1.30931 WP_002209521.1.311 WP_002209521.1.31336 WP_002209521.1.31496 WP_002209521.1.31721 WP_002209521.1.31739 WP_002209521.1.31805 WP_002209521.1.32343 WP_002209521.1.32388 WP_002209521.1.32446 WP_002209521.1.32736 WP_002209521.1.33203 WP_002209521.1.33324 WP_002209521.1.33661 WP_002209521.1.33775 WP_002209521.1.33937 WP_002209521.1.34031 WP_002209521.1.34138 WP_002209521.1.35389 WP_002209521.1.35538 WP_002209521.1.36088 WP_002209521.1.37494 WP_002209521.1.37863 WP_002209521.1.38147 WP_002209521.1.38235 WP_002209521.1.38532 WP_002209521.1.38743 WP_002209521.1.38824 WP_002209521.1.38993 WP_002209521.1.39066 WP_002209521.1.39346 WP_002209521.1.3976 WP_002209521.1.39858 WP_002209521.1.40071 WP_002209521.1.40134 WP_002209521.1.40534 WP_002209521.1.40853 WP_002209521.1.41196 WP_002209521.1.42361 WP_002209521.1.42490 WP_002209521.1.42976 WP_002209521.1.44408 WP_002209521.1.44598 WP_002209521.1.44603 WP_002209521.1.44832 WP_002209521.1.45198 WP_002209521.1.45214 WP_002209521.1.46262 WP_002209521.1.46545 WP_002209521.1.46686 WP_002209521.1.46697 WP_002209521.1.46731 WP_002209521.1.4678 WP_002209521.1.46891 WP_002209521.1.47387 WP_002209521.1.47440 WP_002209521.1.47881 WP_002209521.1.48166 WP_002209521.1.48722 WP_002209521.1.4889 WP_002209521.1.49315 WP_002209521.1.49906 WP_002209521.1.4997 WP_002209521.1.50010 WP_002209521.1.50093 WP_002209521.1.50106 WP_002209521.1.50185 WP_002209521.1.50984 WP_002209521.1.51284 WP_002209521.1.51293 WP_002209521.1.51588 WP_002209521.1.51772 WP_002209521.1.51934 WP_002209521.1.52158 WP_002209521.1.52247 WP_002209521.1.52473 WP_002209521.1.52734 WP_002209521.1.52792 WP_002209521.1.52819 WP_002209521.1.52969 WP_002209521.1.53147 WP_002209521.1.53300 WP_002209521.1.53838 WP_002209521.1.53848 WP_002209521.1.53883 WP_002209521.1.53953 WP_002209521.1.54568 WP_002209521.1.54951 WP_002209521.1.55194 WP_002209521.1.55695 WP_002209521.1.5592 WP_002209521.1.56031 WP_002209521.1.56912 WP_002209521.1.56953 WP_002209521.1.57585 WP_002209521.1.57657 WP_002209521.1.58067 WP_002209521.1.58543 WP_002209521.1.58794 WP_002209521.1.59102 WP_002209521.1.59431 WP_002209521.1.5957 WP_002209521.1.59635 WP_002209521.1.5968 WP_002209521.1.59687 WP_002209521.1.59789 WP_002209521.1.59885 WP_002209521.1.60437 WP_002209521.1.60707 WP_002209521.1.60896 WP_002209521.1.61689 WP_002209521.1.62232 WP_002209521.1.62342 WP_002209521.1.6270 WP_002209521.1.6333 WP_002209521.1.63387 WP_002209521.1.63641 WP_002209521.1.64142 WP_002209521.1.64474 WP_002209521.1.64780 WP_002209521.1.64786 WP_002209521.1.64910 WP_002209521.1.653 WP_002209521.1.65400 WP_002209521.1.65554 WP_002209521.1.6570 WP_002209521.1.65706 WP_002209521.1.65718 WP_002209521.1.6581 WP_002209521.1.66118 WP_002209521.1.66546 WP_002209521.1.66616 WP_002209521.1.67404 WP_002209521.1.67850 WP_002209521.1.6791 WP_002209521.1.68361 WP_002209521.1.68371 WP_002209521.1.68855 WP_002209521.1.69018 WP_002209521.1.69316 WP_002209521.1.69951 WP_002209521.1.70117 WP_002209521.1.70171 WP_002209521.1.70319 WP_002209521.1.70377 WP_002209521.1.70417 WP_002209521.1.70726 WP_002209521.1.7083 WP_002209521.1.7169 WP_002209521.1.71744 WP_002209521.1.72280 WP_002209521.1.72440 WP_002209521.1.72486 WP_002209521.1.7402 WP_002209521.1.74131 WP_002209521.1.74310 WP_002209521.1.74577 WP_002209521.1.74738 WP_002209521.1.75169 WP_002209521.1.75173 WP_002209521.1.7518 WP_002209521.1.75208 WP_002209521.1.75337 WP_002209521.1.75407 WP_002209521.1.75636 WP_002209521.1.75689 WP_002209521.1.75821 WP_002209521.1.76555 WP_002209521.1.76670 WP_002209521.1.77295 WP_002209521.1.77387 WP_002209521.1.77429 WP_002209521.1.77569 WP_002209521.1.77691 WP_002209521.1.78004 WP_002209521.1.7841 WP_002209521.1.78556 WP_002209521.1.79515 WP_002209521.1.79550 WP_002209521.1.79609 WP_002209521.1.79825 WP_002209521.1.79981 WP_002209521.1.8009 WP_002209521.1.80331 WP_002209521.1.81848 WP_002209521.1.81877 WP_002209521.1.8210 WP_002209521.1.82133 WP_002209521.1.82151 WP_002209521.1.82270 WP_002209521.1.82436 WP_002209521.1.82619 WP_002209521.1.8303 WP_002209521.1.83039 WP_002209521.1.83265 WP_002209521.1.83630 WP_002209521.1.8420 WP_002209521.1.84720 WP_002209521.1.85269 WP_002209521.1.85270 WP_002209521.1.8559 WP_002209521.1.85802 WP_002209521.1.86034 WP_002209521.1.86059 WP_002209521.1.86413 WP_002209521.1.87107 WP_002209521.1.8728 WP_002209521.1.87418 WP_002209521.1.8762 WP_002209521.1.87853 WP_002209521.1.87988 WP_002209521.1.88362 WP_002209521.1.88472 WP_002209521.1.89359 WP_002209521.1.89542 WP_002209521.1.8964 WP_002209521.1.90176 WP_002209521.1.9051 WP_002209521.1.90624 WP_002209521.1.91263 WP_002209521.1.91373 WP_002209521.1.91844 WP_002209521.1.92030 WP_002209521.1.92331 WP_002209521.1.92604 WP_002209521.1.927 WP_002209521.1.9311 WP_002209521.1.9320 WP_002209521.1.93623 WP_002209521.1.93928 WP_002209521.1.93933 WP_002209521.1.94052 WP_002209521.1.94201 WP_002209521.1.94545 WP_002209521.1.94683 WP_002209521.1.95746 WP_002209521.1.95981 WP_002209521.1.97245 WP_002209521.1.97375 WP_002209521.1.97448 WP_002209521.1.97791 WP_002209521.1.97864 WP_002209521.1.97872 WP_002209521.1.97894 WP_002209521.1.99109 WP_002209521.1.99383 WP_002209521.1.9941 WP_002209521.1.99416 WP_002209521.1.99788 WP_002209521.1.99882 WP_002209521.1.99972 WP_002209521.1.99990 YP_002348833.1.25044 gi|384127934|ref|YP_005510548.1| gi|51598095|ref|YP_072286.1| gi|218930958|ref|YP_002348833.1| gi|45443074|ref|NP_994613.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]