SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145600714|ref|YP_001164790.1| from Yersinia pestis Pestoides F

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145600714|ref|YP_001164790.1|
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 1.92e-39
Family Frataxin-like 0.00000725
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|145600714|ref|YP_001164790.1|
Sequence length 106
Comment frataxin-like protein [Yersinia pestis Pestoides F]
Sequence
MNDSEFHQLADQLMLYIEETLDSFTGDSDIDYETNGGVMTLTFENGSKIVINRQEPLHQV
WLATKAGGYHFNYRDGHWYCSRSGEEFLAKLSEAASAQAGENVSFG
Download sequence
Identical sequences A0A0E1NTB0 A0A0M1V489 A0A154RT55 A0A208S2F9 A4TRA5 A9R8K3 P46356 Q1CBM8 Q1CNI0
gi|384127840|ref|YP_005510454.1| gi|162420225|ref|YP_001605132.1| gi|384413051|ref|YP_005622413.1| gi|108810283|ref|YP_646050.1| gi|384123980|ref|YP_005506600.1| gi|108806173|ref|YP_650089.1| WP_002211469.1.100083 WP_002211469.1.100246 WP_002211469.1.100921 WP_002211469.1.100931 WP_002211469.1.10105 WP_002211469.1.101305 WP_002211469.1.101382 WP_002211469.1.101928 WP_002211469.1.102012 WP_002211469.1.102067 WP_002211469.1.10736 WP_002211469.1.10935 WP_002211469.1.10955 WP_002211469.1.11693 WP_002211469.1.12463 WP_002211469.1.12736 WP_002211469.1.12857 WP_002211469.1.1388 WP_002211469.1.14063 WP_002211469.1.14804 WP_002211469.1.15321 WP_002211469.1.15555 WP_002211469.1.15605 WP_002211469.1.15689 WP_002211469.1.16243 WP_002211469.1.16333 WP_002211469.1.17135 WP_002211469.1.17141 WP_002211469.1.17608 WP_002211469.1.17873 WP_002211469.1.17983 WP_002211469.1.18208 WP_002211469.1.18640 WP_002211469.1.18826 WP_002211469.1.19329 WP_002211469.1.19425 WP_002211469.1.19739 WP_002211469.1.19763 WP_002211469.1.20035 WP_002211469.1.2064 WP_002211469.1.21486 WP_002211469.1.21784 WP_002211469.1.21879 WP_002211469.1.22530 WP_002211469.1.22542 WP_002211469.1.22708 WP_002211469.1.23157 WP_002211469.1.23271 WP_002211469.1.23687 WP_002211469.1.24002 WP_002211469.1.2451 WP_002211469.1.25181 WP_002211469.1.25394 WP_002211469.1.2640 WP_002211469.1.26776 WP_002211469.1.26960 WP_002211469.1.27124 WP_002211469.1.27251 WP_002211469.1.2726 WP_002211469.1.28647 WP_002211469.1.28922 WP_002211469.1.29157 WP_002211469.1.29355 WP_002211469.1.29622 WP_002211469.1.2964 WP_002211469.1.29685 WP_002211469.1.29814 WP_002211469.1.3092 WP_002211469.1.30931 WP_002211469.1.311 WP_002211469.1.31336 WP_002211469.1.31496 WP_002211469.1.31739 WP_002211469.1.31805 WP_002211469.1.32343 WP_002211469.1.32388 WP_002211469.1.32446 WP_002211469.1.33203 WP_002211469.1.33661 WP_002211469.1.33937 WP_002211469.1.34031 WP_002211469.1.34138 WP_002211469.1.35389 WP_002211469.1.35538 WP_002211469.1.36088 WP_002211469.1.37174 WP_002211469.1.37494 WP_002211469.1.37863 WP_002211469.1.38147 WP_002211469.1.38235 WP_002211469.1.38743 WP_002211469.1.38824 WP_002211469.1.38993 WP_002211469.1.39066 WP_002211469.1.39346 WP_002211469.1.3976 WP_002211469.1.40071 WP_002211469.1.40134 WP_002211469.1.40534 WP_002211469.1.40853 WP_002211469.1.41196 WP_002211469.1.4210 WP_002211469.1.42490 WP_002211469.1.44408 WP_002211469.1.44598 WP_002211469.1.44603 WP_002211469.1.44832 WP_002211469.1.45198 WP_002211469.1.45214 WP_002211469.1.46262 WP_002211469.1.46545 WP_002211469.1.46686 WP_002211469.1.46731 WP_002211469.1.4678 WP_002211469.1.46891 WP_002211469.1.47387 WP_002211469.1.47440 WP_002211469.1.48166 WP_002211469.1.48722 WP_002211469.1.4889 WP_002211469.1.49906 WP_002211469.1.4997 WP_002211469.1.50010 WP_002211469.1.50093 WP_002211469.1.50106 WP_002211469.1.50984 WP_002211469.1.51284 WP_002211469.1.51293 WP_002211469.1.51588 WP_002211469.1.51772 WP_002211469.1.51934 WP_002211469.1.52158 WP_002211469.1.52247 WP_002211469.1.52734 WP_002211469.1.52819 WP_002211469.1.52969 WP_002211469.1.53300 WP_002211469.1.53838 WP_002211469.1.53848 WP_002211469.1.53953 WP_002211469.1.54568 WP_002211469.1.54951 WP_002211469.1.55194 WP_002211469.1.55695 WP_002211469.1.5592 WP_002211469.1.56031 WP_002211469.1.56912 WP_002211469.1.56953 WP_002211469.1.57585 WP_002211469.1.57657 WP_002211469.1.58067 WP_002211469.1.58794 WP_002211469.1.59102 WP_002211469.1.59431 WP_002211469.1.5957 WP_002211469.1.59635 WP_002211469.1.59687 WP_002211469.1.59789 WP_002211469.1.59885 WP_002211469.1.60437 WP_002211469.1.60707 WP_002211469.1.60896 WP_002211469.1.61689 WP_002211469.1.62232 WP_002211469.1.62342 WP_002211469.1.6270 WP_002211469.1.63387 WP_002211469.1.64142 WP_002211469.1.64474 WP_002211469.1.64780 WP_002211469.1.64786 WP_002211469.1.64910 WP_002211469.1.653 WP_002211469.1.65400 WP_002211469.1.65554 WP_002211469.1.6570 WP_002211469.1.65706 WP_002211469.1.65718 WP_002211469.1.6581 WP_002211469.1.66118 WP_002211469.1.66546 WP_002211469.1.66616 WP_002211469.1.67404 WP_002211469.1.67850 WP_002211469.1.68361 WP_002211469.1.68753 WP_002211469.1.68855 WP_002211469.1.69018 WP_002211469.1.69316 WP_002211469.1.69951 WP_002211469.1.70117 WP_002211469.1.70171 WP_002211469.1.70319 WP_002211469.1.70377 WP_002211469.1.70417 WP_002211469.1.70726 WP_002211469.1.7083 WP_002211469.1.7169 WP_002211469.1.71744 WP_002211469.1.72280 WP_002211469.1.72486 WP_002211469.1.7402 WP_002211469.1.74131 WP_002211469.1.74310 WP_002211469.1.74577 WP_002211469.1.74738 WP_002211469.1.75173 WP_002211469.1.7518 WP_002211469.1.75337 WP_002211469.1.75407 WP_002211469.1.75636 WP_002211469.1.75689 WP_002211469.1.75821 WP_002211469.1.76670 WP_002211469.1.77387 WP_002211469.1.77429 WP_002211469.1.77691 WP_002211469.1.78004 WP_002211469.1.7841 WP_002211469.1.78556 WP_002211469.1.79515 WP_002211469.1.79550 WP_002211469.1.79609 WP_002211469.1.79981 WP_002211469.1.8009 WP_002211469.1.80331 WP_002211469.1.81848 WP_002211469.1.81877 WP_002211469.1.8210 WP_002211469.1.82133 WP_002211469.1.82151 WP_002211469.1.82270 WP_002211469.1.82619 WP_002211469.1.8303 WP_002211469.1.83039 WP_002211469.1.83265 WP_002211469.1.8420 WP_002211469.1.84703 WP_002211469.1.84720 WP_002211469.1.85269 WP_002211469.1.85270 WP_002211469.1.8559 WP_002211469.1.85802 WP_002211469.1.86034 WP_002211469.1.86413 WP_002211469.1.87107 WP_002211469.1.8728 WP_002211469.1.87418 WP_002211469.1.8762 WP_002211469.1.87853 WP_002211469.1.87988 WP_002211469.1.88362 WP_002211469.1.88472 WP_002211469.1.89359 WP_002211469.1.8964 WP_002211469.1.90176 WP_002211469.1.9051 WP_002211469.1.90624 WP_002211469.1.91373 WP_002211469.1.91844 WP_002211469.1.92030 WP_002211469.1.92331 WP_002211469.1.92604 WP_002211469.1.927 WP_002211469.1.9311 WP_002211469.1.9320 WP_002211469.1.93623 WP_002211469.1.93928 WP_002211469.1.93933 WP_002211469.1.94052 WP_002211469.1.94201 WP_002211469.1.94545 WP_002211469.1.94683 WP_002211469.1.95746 WP_002211469.1.95981 WP_002211469.1.97245 WP_002211469.1.97375 WP_002211469.1.97448 WP_002211469.1.97791 WP_002211469.1.97864 WP_002211469.1.97872 WP_002211469.1.97894 WP_002211469.1.99109 WP_002211469.1.99383 WP_002211469.1.9941 WP_002211469.1.99788 WP_002211469.1.99990 YP_002348725.1.25044 gi|294505510|ref|YP_003569572.1| 214092.YPO3847 349746.YpAngola_A0539 360102.YPA_0175 377628.YPN_0117 386656.YPDSF_3464 gi|145600714|ref|YP_001164790.1| gi|384138295|ref|YP_005520997.1| gi|218930850|ref|YP_002348725.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]