SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145601018|ref|YP_001165094.1| from Yersinia pestis Pestoides F

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145601018|ref|YP_001165094.1|
Domain Number 1 Region: 10-304
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.69e-40
Family L-arabinose binding protein-like 0.0026
Further Details:      
 
Domain Number 2 Region: 343-392
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000028
Family AraC type transcriptional activator 0.023
Further Details:      
 
Domain Number 3 Region: 289-337
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000202
Family Tetracyclin repressor-like, N-terminal domain 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|145601018|ref|YP_001165094.1|
Sequence length 397
Comment AraC family transcription regulator [Yersinia pestis Pestoides F]
Sequence
MFEKRYRITLLFNANKVYDRQVVEGVGEYLQASQCNWDIFIEEDFRCRIDNIKDWLGDGV
IADFDDRQIEQLLANVNVPIVGVGGSYHQSEDYPSVDYIATDNKALVNAAFMHLKEKGLN
RFAFYGLPASCGMRWAQEREYAFRQLVSAEQYQGVVYQGMATAPDNWQYAQNRLADWVQT
LPHQTGIIAVTDARARHLLQVCEHLDIAVPEKLSVIGIDNEELTRYLSRVALSSVVQGTR
QMGYRAAKLLHQRLKLRQKQQTDPPLQRILVPPVKVMARRSTDFRSLRDPAVIQAMHYIR
HHACKGIKVEQVLDAVGMSRSNLEKRFKDEVGQTIHGVIHEEKLDRARNLLAATSLPINE
ISQMCGYPSLQYFYSVFKKGYSITPKEHRDKYGEVSY
Download sequence
Identical sequences A0A0E1NTJ3 A0A0H2W8K9 A0A0H2YLY7 A0A0H3AY83 A0A0M1VAT1 A0A0U1EW77 A0A0U1QZE0 A0A208S1C2 A0A2A7VLT9 Q663Y7 Q7CFR3
gi|145601018|ref|YP_001165094.1| gi|162421168|ref|YP_001608431.1| WP_002209588.1.100083 WP_002209588.1.100246 WP_002209588.1.100593 WP_002209588.1.10066 WP_002209588.1.100921 WP_002209588.1.100931 WP_002209588.1.10105 WP_002209588.1.101305 WP_002209588.1.101382 WP_002209588.1.101928 WP_002209588.1.102012 WP_002209588.1.102067 WP_002209588.1.10736 WP_002209588.1.10935 WP_002209588.1.10955 WP_002209588.1.11693 WP_002209588.1.12167 WP_002209588.1.12463 WP_002209588.1.12736 WP_002209588.1.12857 WP_002209588.1.1388 WP_002209588.1.14063 WP_002209588.1.14169 WP_002209588.1.14804 WP_002209588.1.15321 WP_002209588.1.15555 WP_002209588.1.15605 WP_002209588.1.15689 WP_002209588.1.16243 WP_002209588.1.16333 WP_002209588.1.17135 WP_002209588.1.17141 WP_002209588.1.17608 WP_002209588.1.17873 WP_002209588.1.17983 WP_002209588.1.18208 WP_002209588.1.18640 WP_002209588.1.18826 WP_002209588.1.19329 WP_002209588.1.19425 WP_002209588.1.19739 WP_002209588.1.20035 WP_002209588.1.20380 WP_002209588.1.20547 WP_002209588.1.2064 WP_002209588.1.20932 WP_002209588.1.21486 WP_002209588.1.21784 WP_002209588.1.21879 WP_002209588.1.21934 WP_002209588.1.22530 WP_002209588.1.22542 WP_002209588.1.22708 WP_002209588.1.23157 WP_002209588.1.23271 WP_002209588.1.23687 WP_002209588.1.23811 WP_002209588.1.24002 WP_002209588.1.2451 WP_002209588.1.24517 WP_002209588.1.25181 WP_002209588.1.25394 WP_002209588.1.26383 WP_002209588.1.2640 WP_002209588.1.26776 WP_002209588.1.26960 WP_002209588.1.27124 WP_002209588.1.27251 WP_002209588.1.2726 WP_002209588.1.28647 WP_002209588.1.28922 WP_002209588.1.29157 WP_002209588.1.29355 WP_002209588.1.2947 WP_002209588.1.29622 WP_002209588.1.2964 WP_002209588.1.29685 WP_002209588.1.29814 WP_002209588.1.3092 WP_002209588.1.30931 WP_002209588.1.311 WP_002209588.1.31336 WP_002209588.1.31496 WP_002209588.1.31739 WP_002209588.1.31805 WP_002209588.1.32343 WP_002209588.1.32388 WP_002209588.1.32446 WP_002209588.1.32736 WP_002209588.1.33203 WP_002209588.1.33324 WP_002209588.1.33661 WP_002209588.1.33937 WP_002209588.1.34031 WP_002209588.1.34138 WP_002209588.1.35389 WP_002209588.1.35538 WP_002209588.1.36088 WP_002209588.1.37174 WP_002209588.1.37494 WP_002209588.1.37863 WP_002209588.1.38147 WP_002209588.1.38235 WP_002209588.1.38532 WP_002209588.1.38743 WP_002209588.1.38824 WP_002209588.1.38993 WP_002209588.1.39066 WP_002209588.1.39346 WP_002209588.1.3976 WP_002209588.1.39858 WP_002209588.1.40071 WP_002209588.1.40134 WP_002209588.1.40534 WP_002209588.1.40853 WP_002209588.1.41196 WP_002209588.1.4210 WP_002209588.1.42361 WP_002209588.1.42490 WP_002209588.1.42976 WP_002209588.1.44408 WP_002209588.1.44603 WP_002209588.1.44832 WP_002209588.1.45198 WP_002209588.1.45214 WP_002209588.1.46262 WP_002209588.1.46545 WP_002209588.1.46686 WP_002209588.1.46697 WP_002209588.1.46731 WP_002209588.1.4678 WP_002209588.1.46891 WP_002209588.1.47387 WP_002209588.1.47440 WP_002209588.1.47881 WP_002209588.1.48166 WP_002209588.1.48722 WP_002209588.1.4889 WP_002209588.1.49315 WP_002209588.1.49906 WP_002209588.1.4997 WP_002209588.1.50010 WP_002209588.1.50093 WP_002209588.1.50106 WP_002209588.1.50185 WP_002209588.1.50984 WP_002209588.1.51284 WP_002209588.1.51293 WP_002209588.1.51588 WP_002209588.1.51772 WP_002209588.1.51934 WP_002209588.1.52158 WP_002209588.1.52247 WP_002209588.1.52473 WP_002209588.1.52734 WP_002209588.1.52792 WP_002209588.1.52819 WP_002209588.1.52969 WP_002209588.1.53147 WP_002209588.1.53300 WP_002209588.1.53838 WP_002209588.1.53848 WP_002209588.1.53883 WP_002209588.1.53953 WP_002209588.1.54568 WP_002209588.1.54951 WP_002209588.1.55194 WP_002209588.1.55695 WP_002209588.1.5592 WP_002209588.1.56031 WP_002209588.1.56912 WP_002209588.1.56953 WP_002209588.1.57585 WP_002209588.1.57657 WP_002209588.1.58067 WP_002209588.1.58543 WP_002209588.1.58794 WP_002209588.1.59102 WP_002209588.1.59431 WP_002209588.1.5957 WP_002209588.1.59635 WP_002209588.1.59687 WP_002209588.1.59789 WP_002209588.1.59885 WP_002209588.1.60437 WP_002209588.1.60707 WP_002209588.1.60896 WP_002209588.1.61689 WP_002209588.1.62232 WP_002209588.1.62342 WP_002209588.1.6270 WP_002209588.1.6333 WP_002209588.1.63387 WP_002209588.1.63641 WP_002209588.1.64142 WP_002209588.1.64474 WP_002209588.1.64780 WP_002209588.1.64786 WP_002209588.1.64910 WP_002209588.1.653 WP_002209588.1.65400 WP_002209588.1.65554 WP_002209588.1.6570 WP_002209588.1.65706 WP_002209588.1.65718 WP_002209588.1.6581 WP_002209588.1.66118 WP_002209588.1.66546 WP_002209588.1.66616 WP_002209588.1.67404 WP_002209588.1.67850 WP_002209588.1.6791 WP_002209588.1.68361 WP_002209588.1.68371 WP_002209588.1.68753 WP_002209588.1.68855 WP_002209588.1.69018 WP_002209588.1.69951 WP_002209588.1.70117 WP_002209588.1.70171 WP_002209588.1.70319 WP_002209588.1.70377 WP_002209588.1.70417 WP_002209588.1.70726 WP_002209588.1.7083 WP_002209588.1.7169 WP_002209588.1.71744 WP_002209588.1.72280 WP_002209588.1.72440 WP_002209588.1.72486 WP_002209588.1.7402 WP_002209588.1.74131 WP_002209588.1.74310 WP_002209588.1.74577 WP_002209588.1.74738 WP_002209588.1.75173 WP_002209588.1.7518 WP_002209588.1.75208 WP_002209588.1.75337 WP_002209588.1.75407 WP_002209588.1.75636 WP_002209588.1.75821 WP_002209588.1.76555 WP_002209588.1.76670 WP_002209588.1.77387 WP_002209588.1.77429 WP_002209588.1.77691 WP_002209588.1.78004 WP_002209588.1.7841 WP_002209588.1.78556 WP_002209588.1.79515 WP_002209588.1.79550 WP_002209588.1.79609 WP_002209588.1.79981 WP_002209588.1.8009 WP_002209588.1.80331 WP_002209588.1.81848 WP_002209588.1.81877 WP_002209588.1.8210 WP_002209588.1.82133 WP_002209588.1.82151 WP_002209588.1.82270 WP_002209588.1.82436 WP_002209588.1.82619 WP_002209588.1.8303 WP_002209588.1.83039 WP_002209588.1.83265 WP_002209588.1.83630 WP_002209588.1.8420 WP_002209588.1.84703 WP_002209588.1.84720 WP_002209588.1.85269 WP_002209588.1.85270 WP_002209588.1.8559 WP_002209588.1.85802 WP_002209588.1.86034 WP_002209588.1.86059 WP_002209588.1.86413 WP_002209588.1.87107 WP_002209588.1.8728 WP_002209588.1.87418 WP_002209588.1.8762 WP_002209588.1.87853 WP_002209588.1.87988 WP_002209588.1.88362 WP_002209588.1.88472 WP_002209588.1.89359 WP_002209588.1.8964 WP_002209588.1.90176 WP_002209588.1.9051 WP_002209588.1.90624 WP_002209588.1.91373 WP_002209588.1.91844 WP_002209588.1.92030 WP_002209588.1.92331 WP_002209588.1.927 WP_002209588.1.9311 WP_002209588.1.9320 WP_002209588.1.93623 WP_002209588.1.93928 WP_002209588.1.93933 WP_002209588.1.94052 WP_002209588.1.94201 WP_002209588.1.94545 WP_002209588.1.94683 WP_002209588.1.95746 WP_002209588.1.95981 WP_002209588.1.97245 WP_002209588.1.97375 WP_002209588.1.97448 WP_002209588.1.97791 WP_002209588.1.97864 WP_002209588.1.97872 WP_002209588.1.97894 WP_002209588.1.99109 WP_002209588.1.99383 WP_002209588.1.9941 WP_002209588.1.99416 WP_002209588.1.99788 WP_002209588.1.99882 WP_002209588.1.99990 YP_002348897.1.25044 gi|51598172|ref|YP_072363.1| gi|384416856|ref|YP_005626218.1| 187410.y4053 214092.YPO4034 229193.YP_3396 273123.YPTB3887 349746.YpAngola_A4155 349747.YpsIP31758_4098 360102.YPA_4124 377628.YPN_3681 386656.YPDSF_3776 502800.YPK_0060 502801.YPTS_4104 gi|153949200|ref|YP_001403042.1| gi|45443141|ref|NP_994680.1| gi|108813841|ref|YP_649608.1| gi|218931022|ref|YP_002348897.1| gi|22127923|ref|NP_671346.1| gi|384128001|ref|YP_005510615.1| gi|170022322|ref|YP_001718827.1| gi|384138116|ref|YP_005520818.1| gi|108810114|ref|YP_654030.1| gi|384124135|ref|YP_005506755.1| gi|186897395|ref|YP_001874507.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]