SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145598731|ref|YP_001162807.1| from Yersinia pestis Pestoides F

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145598731|ref|YP_001162807.1|
Domain Number 1 Region: 56-505
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.95e-118
Family Pyridoxal-dependent decarboxylase 0.0000683
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|145598731|ref|YP_001162807.1|
Sequence length 515
Comment decarboxylase [Yersinia pestis Pestoides F]
Sequence
MYKDIYEENHFIDQGNDITDVLCLENFLNKDSAEHYYENVNNITARIKAVFTLVDKPFSG
VLPSELSPDFYCIDLNQPLTSLDSALDELQQLYIKDAIYFHHPKYVAHLNCPVVLPAVLA
ESIISTLNSSLDTWDQSAGATLIEQKVLDWTRDKMALGSQGDGIFTSGGTQSNLMAILLA
RDHFCHQRDANHQNKLQGLPADSHKFRIFTSVVSHFSTQKAAALLGLGYNAVVAVPYDSE
FKMDAQALDQSIALCLSQGNIPLAIVATTGTTDFGSIDPLHTISTLAKQYGLWLHVDAAY
GCGLLVSSHYEQLLSGIEMADSVTVDYHKSFFQPVSCSAFFVKDKQHFSYLTYHAEYLNP
LTASLEGTPNLVNKSIQTTRRFDALKLWLTLRIMGAKQLGLAFEHVMDTAQQAYQLMLPN
PYFELIHRPVLSTLVFRFMPEQPRSDDDIDRTNAYIRKALFREGHTVIAGTKVNGKQYLK
FTFLNPTTTLQHLNEIVDAIITEGKNYPTLYNSQS
Download sequence
Identical sequences WP_011906256.1.1388 WP_011906256.1.16243 WP_011906256.1.17608 WP_011906256.1.23687 WP_011906256.1.25181 WP_011906256.1.29622 WP_011906256.1.29685 WP_011906256.1.37494 WP_011906256.1.3976 WP_011906256.1.44408 WP_011906256.1.46731 WP_011906256.1.60707 WP_011906256.1.60896 WP_011906256.1.72486 WP_011906256.1.75636 WP_011906256.1.8009 WP_011906256.1.8762 WP_011906256.1.90624 WP_011906256.1.92030 386656.YPDSF_1447 gi|145598731|ref|YP_001162807.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]