SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145598893|ref|YP_001162969.1| from Yersinia pestis Pestoides F

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145598893|ref|YP_001162969.1|
Domain Number 1 Region: 1-99
Classification Level Classification E-value
Superfamily Urease, gamma-subunit 8.79e-67
Family SCOPe 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|145598893|ref|YP_001162969.1|
Sequence length 100
Comment urease subunit gamma [Yersinia pestis Pestoides F]
Sequence
MQLTPREVEKLMIYTLSDVAFKRKARGLKLNYPEAVSIITVTAMEGARDGKSVEDVMKEA
SKVLTKDDVMDGVADLIPNVQVEAIFTDGSRLVTVHDPIK
Download sequence
Identical sequences A0A0B6FMN3 A0A0B6I6R6 A0A0E1NYX2 A0A0E8XPK0 A0A0H3NXW2 A0A0T9J1M9 A0A0T9NHH6 A0A0T9QMJ3 A0A0T9QMY4 A0A0T9RYY8 A0A0T9UF34 A0A0U1I4K0 A0A154MZ69 A0A208S7T5 A1JKD7 A4TL34 A7FFN0 B1JR69 B2KAA6 C4SAX9 C4STM1 F4MWM9 P69994 P69995 Q1C5B5 Q1CKK1 Q2L860 Q6UR44 Q6UR53 Q6UR62 Q6UR70 Q6UR78
gi|123441298|ref|YP_001005285.1| gi|384126782|ref|YP_005509396.1| 4z42_A 4z42_D 4z42_G 4z42_J gi|294504459|ref|YP_003568521.1| gi|332162751|ref|YP_004299328.1| gi|108808386|ref|YP_652302.1| 187410.y1237 214092.YPO2665 229193.YP_2466 273123.YPTB2944 349747.YpsIP31758_1077 360102.YPA_2392 377628.YPN_1149 386656.YPDSF_1611 393305.YE0951 502800.YPK_1131 502801.YPTS_3060 gi|153948311|ref|YP_001400058.1| gi|384415624|ref|YP_005624986.1| gi|51597259|ref|YP_071450.1| gi|384122953|ref|YP_005505573.1| gi|384139503|ref|YP_005522205.1| gi|186896362|ref|YP_001873474.1| gi|45442250|ref|NP_993789.1| gi|170023377|ref|YP_001719882.1| gi|218929739|ref|YP_002347614.1| gi|108811312|ref|YP_647079.1| WP_002215288.1.100034 WP_002215288.1.100083 WP_002215288.1.100200 WP_002215288.1.100246 WP_002215288.1.100500 WP_002215288.1.100593 WP_002215288.1.10066 WP_002215288.1.100921 WP_002215288.1.100931 WP_002215288.1.10105 WP_002215288.1.101305 WP_002215288.1.101382 WP_002215288.1.101928 WP_002215288.1.101998 WP_002215288.1.102012 WP_002215288.1.102067 WP_002215288.1.102102 WP_002215288.1.10535 WP_002215288.1.10736 WP_002215288.1.10935 WP_002215288.1.10955 WP_002215288.1.111 WP_002215288.1.11347 WP_002215288.1.11693 WP_002215288.1.11800 WP_002215288.1.12167 WP_002215288.1.12212 WP_002215288.1.12463 WP_002215288.1.12736 WP_002215288.1.12857 WP_002215288.1.13354 WP_002215288.1.1388 WP_002215288.1.13969 WP_002215288.1.13971 WP_002215288.1.14063 WP_002215288.1.14169 WP_002215288.1.14274 WP_002215288.1.14282 WP_002215288.1.14567 WP_002215288.1.14804 WP_002215288.1.15321 WP_002215288.1.15520 WP_002215288.1.15555 WP_002215288.1.15605 WP_002215288.1.15689 WP_002215288.1.16 WP_002215288.1.16243 WP_002215288.1.16333 WP_002215288.1.16413 WP_002215288.1.16548 WP_002215288.1.16645 WP_002215288.1.16723 WP_002215288.1.17047 WP_002215288.1.17135 WP_002215288.1.17141 WP_002215288.1.17362 WP_002215288.1.17608 WP_002215288.1.17873 WP_002215288.1.17975 WP_002215288.1.17983 WP_002215288.1.18208 WP_002215288.1.18640 WP_002215288.1.18790 WP_002215288.1.18826 WP_002215288.1.18893 WP_002215288.1.19087 WP_002215288.1.19252 WP_002215288.1.19329 WP_002215288.1.19425 WP_002215288.1.19739 WP_002215288.1.19763 WP_002215288.1.20035 WP_002215288.1.20319 WP_002215288.1.20380 WP_002215288.1.20547 WP_002215288.1.20582 WP_002215288.1.2064 WP_002215288.1.20762 WP_002215288.1.20932 WP_002215288.1.21486 WP_002215288.1.21708 WP_002215288.1.21784 WP_002215288.1.21879 WP_002215288.1.21934 WP_002215288.1.22054 WP_002215288.1.22156 WP_002215288.1.22252 WP_002215288.1.22530 WP_002215288.1.22542 WP_002215288.1.22708 WP_002215288.1.23157 WP_002215288.1.23271 WP_002215288.1.23687 WP_002215288.1.23689 WP_002215288.1.23750 WP_002215288.1.23811 WP_002215288.1.24002 WP_002215288.1.24393 WP_002215288.1.24455 WP_002215288.1.2451 WP_002215288.1.24517 WP_002215288.1.2482 WP_002215288.1.25150 WP_002215288.1.25181 WP_002215288.1.25286 WP_002215288.1.25394 WP_002215288.1.26383 WP_002215288.1.2640 WP_002215288.1.26415 WP_002215288.1.26509 WP_002215288.1.26676 WP_002215288.1.26770 WP_002215288.1.26776 WP_002215288.1.2681 WP_002215288.1.26960 WP_002215288.1.26976 WP_002215288.1.27124 WP_002215288.1.27204 WP_002215288.1.27215 WP_002215288.1.27251 WP_002215288.1.2726 WP_002215288.1.27291 WP_002215288.1.2756 WP_002215288.1.27663 WP_002215288.1.27919 WP_002215288.1.27954 WP_002215288.1.27965 WP_002215288.1.2833 WP_002215288.1.28335 WP_002215288.1.28488 WP_002215288.1.28647 WP_002215288.1.28922 WP_002215288.1.29157 WP_002215288.1.29173 WP_002215288.1.29186 WP_002215288.1.29200 WP_002215288.1.29355 WP_002215288.1.2947 WP_002215288.1.29622 WP_002215288.1.2964 WP_002215288.1.29685 WP_002215288.1.29814 WP_002215288.1.3092 WP_002215288.1.30931 WP_002215288.1.311 WP_002215288.1.31336 WP_002215288.1.31496 WP_002215288.1.31514 WP_002215288.1.31721 WP_002215288.1.31739 WP_002215288.1.31805 WP_002215288.1.32200 WP_002215288.1.32298 WP_002215288.1.32343 WP_002215288.1.32388 WP_002215288.1.32446 WP_002215288.1.32736 WP_002215288.1.33203 WP_002215288.1.33324 WP_002215288.1.33645 WP_002215288.1.33661 WP_002215288.1.33697 WP_002215288.1.33775 WP_002215288.1.33842 WP_002215288.1.33937 WP_002215288.1.34031 WP_002215288.1.34138 WP_002215288.1.34535 WP_002215288.1.34811 WP_002215288.1.35310 WP_002215288.1.35389 WP_002215288.1.35538 WP_002215288.1.35647 WP_002215288.1.35815 WP_002215288.1.36088 WP_002215288.1.36310 WP_002215288.1.36457 WP_002215288.1.36845 WP_002215288.1.37174 WP_002215288.1.37307 WP_002215288.1.37339 WP_002215288.1.37377 WP_002215288.1.3739 WP_002215288.1.37392 WP_002215288.1.37494 WP_002215288.1.37863 WP_002215288.1.38147 WP_002215288.1.38156 WP_002215288.1.38235 WP_002215288.1.38467 WP_002215288.1.38532 WP_002215288.1.38743 WP_002215288.1.38824 WP_002215288.1.38977 WP_002215288.1.38993 WP_002215288.1.39066 WP_002215288.1.39120 WP_002215288.1.39346 WP_002215288.1.39701 WP_002215288.1.3976 WP_002215288.1.39843 WP_002215288.1.39858 WP_002215288.1.40071 WP_002215288.1.40110 WP_002215288.1.40134 WP_002215288.1.40534 WP_002215288.1.40853 WP_002215288.1.41196 WP_002215288.1.41617 WP_002215288.1.41645 WP_002215288.1.41984 WP_002215288.1.42082 WP_002215288.1.4210 WP_002215288.1.42361 WP_002215288.1.42490 WP_002215288.1.42927 WP_002215288.1.42976 WP_002215288.1.43259 WP_002215288.1.43549 WP_002215288.1.44408 WP_002215288.1.44598 WP_002215288.1.44603 WP_002215288.1.44811 WP_002215288.1.44832 WP_002215288.1.45198 WP_002215288.1.45214 WP_002215288.1.45624 WP_002215288.1.4568 WP_002215288.1.46262 WP_002215288.1.46310 WP_002215288.1.46545 WP_002215288.1.46662 WP_002215288.1.46686 WP_002215288.1.46697 WP_002215288.1.46731 WP_002215288.1.4678 WP_002215288.1.46877 WP_002215288.1.46891 WP_002215288.1.47151 WP_002215288.1.47260 WP_002215288.1.47289 WP_002215288.1.47387 WP_002215288.1.47440 WP_002215288.1.47619 WP_002215288.1.47769 WP_002215288.1.47840 WP_002215288.1.47881 WP_002215288.1.48104 WP_002215288.1.48166 WP_002215288.1.48722 WP_002215288.1.4889 WP_002215288.1.48930 WP_002215288.1.49096 WP_002215288.1.49172 WP_002215288.1.49315 WP_002215288.1.49903 WP_002215288.1.49906 WP_002215288.1.4997 WP_002215288.1.50010 WP_002215288.1.50093 WP_002215288.1.50106 WP_002215288.1.50116 WP_002215288.1.50185 WP_002215288.1.50284 WP_002215288.1.50873 WP_002215288.1.50913 WP_002215288.1.50984 WP_002215288.1.51284 WP_002215288.1.51293 WP_002215288.1.51324 WP_002215288.1.51588 WP_002215288.1.5167 WP_002215288.1.51772 WP_002215288.1.51802 WP_002215288.1.51934 WP_002215288.1.52128 WP_002215288.1.52158 WP_002215288.1.52167 WP_002215288.1.52247 WP_002215288.1.52282 WP_002215288.1.52473 WP_002215288.1.52510 WP_002215288.1.52530 WP_002215288.1.52569 WP_002215288.1.52734 WP_002215288.1.52792 WP_002215288.1.52819 WP_002215288.1.52969 WP_002215288.1.53147 WP_002215288.1.53300 WP_002215288.1.53838 WP_002215288.1.53848 WP_002215288.1.53883 WP_002215288.1.53953 WP_002215288.1.53956 WP_002215288.1.54568 WP_002215288.1.54645 WP_002215288.1.54893 WP_002215288.1.54951 WP_002215288.1.55081 WP_002215288.1.55167 WP_002215288.1.55194 WP_002215288.1.55695 WP_002215288.1.5592 WP_002215288.1.56031 WP_002215288.1.56912 WP_002215288.1.56946 WP_002215288.1.56953 WP_002215288.1.57038 WP_002215288.1.57177 WP_002215288.1.57251 WP_002215288.1.57585 WP_002215288.1.57657 WP_002215288.1.58067 WP_002215288.1.58543 WP_002215288.1.58794 WP_002215288.1.59102 WP_002215288.1.59297 WP_002215288.1.59314 WP_002215288.1.59324 WP_002215288.1.59431 WP_002215288.1.5946 WP_002215288.1.5957 WP_002215288.1.59635 WP_002215288.1.5968 WP_002215288.1.59687 WP_002215288.1.59789 WP_002215288.1.59817 WP_002215288.1.59885 WP_002215288.1.60054 WP_002215288.1.60229 WP_002215288.1.60437 WP_002215288.1.60707 WP_002215288.1.60896 WP_002215288.1.61207 WP_002215288.1.61689 WP_002215288.1.61901 WP_002215288.1.62232 WP_002215288.1.6227 WP_002215288.1.62342 WP_002215288.1.62658 WP_002215288.1.6270 WP_002215288.1.6276 WP_002215288.1.63044 WP_002215288.1.6333 WP_002215288.1.63387 WP_002215288.1.63517 WP_002215288.1.63641 WP_002215288.1.64141 WP_002215288.1.64142 WP_002215288.1.64144 WP_002215288.1.6436 WP_002215288.1.64474 WP_002215288.1.64607 WP_002215288.1.64724 WP_002215288.1.64780 WP_002215288.1.64786 WP_002215288.1.64872 WP_002215288.1.64910 WP_002215288.1.653 WP_002215288.1.65310 WP_002215288.1.65400 WP_002215288.1.65554 WP_002215288.1.6570 WP_002215288.1.65706 WP_002215288.1.65718 WP_002215288.1.6581 WP_002215288.1.66118 WP_002215288.1.6623 WP_002215288.1.66546 WP_002215288.1.66616 WP_002215288.1.67007 WP_002215288.1.67050 WP_002215288.1.67404 WP_002215288.1.67544 WP_002215288.1.67688 WP_002215288.1.67850 WP_002215288.1.6791 WP_002215288.1.68361 WP_002215288.1.68371 WP_002215288.1.68551 WP_002215288.1.68753 WP_002215288.1.68855 WP_002215288.1.69018 WP_002215288.1.69316 WP_002215288.1.6932 WP_002215288.1.69335 WP_002215288.1.69951 WP_002215288.1.70117 WP_002215288.1.70167 WP_002215288.1.70171 WP_002215288.1.70254 WP_002215288.1.7028 WP_002215288.1.70319 WP_002215288.1.7032 WP_002215288.1.70348 WP_002215288.1.70377 WP_002215288.1.70417 WP_002215288.1.70521 WP_002215288.1.70726 WP_002215288.1.7083 WP_002215288.1.7169 WP_002215288.1.71744 WP_002215288.1.71761 WP_002215288.1.72280 WP_002215288.1.72301 WP_002215288.1.72440 WP_002215288.1.72462 WP_002215288.1.72486 WP_002215288.1.72703 WP_002215288.1.72721 WP_002215288.1.73411 WP_002215288.1.73755 WP_002215288.1.73937 WP_002215288.1.73944 WP_002215288.1.73966 WP_002215288.1.7402 WP_002215288.1.74131 WP_002215288.1.74271 WP_002215288.1.74310 WP_002215288.1.74370 WP_002215288.1.74577 WP_002215288.1.74738 WP_002215288.1.75090 WP_002215288.1.75169 WP_002215288.1.75173 WP_002215288.1.7518 WP_002215288.1.75208 WP_002215288.1.75238 WP_002215288.1.75337 WP_002215288.1.75407 WP_002215288.1.75560 WP_002215288.1.75589 WP_002215288.1.75636 WP_002215288.1.75689 WP_002215288.1.75717 WP_002215288.1.75818 WP_002215288.1.75821 WP_002215288.1.7618 WP_002215288.1.76555 WP_002215288.1.76565 WP_002215288.1.76670 WP_002215288.1.77079 WP_002215288.1.77263 WP_002215288.1.77295 WP_002215288.1.7732 WP_002215288.1.77387 WP_002215288.1.77398 WP_002215288.1.77429 WP_002215288.1.77569 WP_002215288.1.77691 WP_002215288.1.78004 WP_002215288.1.78074 WP_002215288.1.7841 WP_002215288.1.78556 WP_002215288.1.78907 WP_002215288.1.78961 WP_002215288.1.78974 WP_002215288.1.79061 WP_002215288.1.79150 WP_002215288.1.79299 WP_002215288.1.79375 WP_002215288.1.7939 WP_002215288.1.79515 WP_002215288.1.79550 WP_002215288.1.79609 WP_002215288.1.79825 WP_002215288.1.79981 WP_002215288.1.8009 WP_002215288.1.80331 WP_002215288.1.80565 WP_002215288.1.80986 WP_002215288.1.81200 WP_002215288.1.81839 WP_002215288.1.8184 WP_002215288.1.81848 WP_002215288.1.81865 WP_002215288.1.81877 WP_002215288.1.82072 WP_002215288.1.8210 WP_002215288.1.82133 WP_002215288.1.82151 WP_002215288.1.82270 WP_002215288.1.82436 WP_002215288.1.82619 WP_002215288.1.82708 WP_002215288.1.82975 WP_002215288.1.8303 WP_002215288.1.83039 WP_002215288.1.83102 WP_002215288.1.83265 WP_002215288.1.83529 WP_002215288.1.83630 WP_002215288.1.8420 WP_002215288.1.84522 WP_002215288.1.84626 WP_002215288.1.84703 WP_002215288.1.84720 WP_002215288.1.8474 WP_002215288.1.84820 WP_002215288.1.85269 WP_002215288.1.85270 WP_002215288.1.85518 WP_002215288.1.85569 WP_002215288.1.8559 WP_002215288.1.85647 WP_002215288.1.85719 WP_002215288.1.85802 WP_002215288.1.85902 WP_002215288.1.86034 WP_002215288.1.86059 WP_002215288.1.86289 WP_002215288.1.86413 WP_002215288.1.86434 WP_002215288.1.87107 WP_002215288.1.8728 WP_002215288.1.87418 WP_002215288.1.8762 WP_002215288.1.87836 WP_002215288.1.87853 WP_002215288.1.87988 WP_002215288.1.88362 WP_002215288.1.88472 WP_002215288.1.88911 WP_002215288.1.89026 WP_002215288.1.89359 WP_002215288.1.89542 WP_002215288.1.8964 WP_002215288.1.90176 WP_002215288.1.9051 WP_002215288.1.90624 WP_002215288.1.91014 WP_002215288.1.91263 WP_002215288.1.91311 WP_002215288.1.91362 WP_002215288.1.91373 WP_002215288.1.91446 WP_002215288.1.91844 WP_002215288.1.92017 WP_002215288.1.92030 WP_002215288.1.92331 WP_002215288.1.92604 WP_002215288.1.927 WP_002215288.1.92887 WP_002215288.1.9311 WP_002215288.1.9320 WP_002215288.1.93623 WP_002215288.1.93928 WP_002215288.1.93933 WP_002215288.1.93960 WP_002215288.1.9401 WP_002215288.1.94052 WP_002215288.1.94201 WP_002215288.1.94545 WP_002215288.1.94591 WP_002215288.1.94615 WP_002215288.1.94683 WP_002215288.1.94794 WP_002215288.1.94848 WP_002215288.1.95746 WP_002215288.1.95930 WP_002215288.1.95981 WP_002215288.1.96208 WP_002215288.1.9637 WP_002215288.1.96818 WP_002215288.1.97152 WP_002215288.1.97245 WP_002215288.1.97375 WP_002215288.1.97448 WP_002215288.1.97603 WP_002215288.1.97791 WP_002215288.1.97864 WP_002215288.1.97872 WP_002215288.1.97894 WP_002215288.1.98085 WP_002215288.1.98465 WP_002215288.1.99109 WP_002215288.1.99238 WP_002215288.1.99287 WP_002215288.1.99383 WP_002215288.1.9941 WP_002215288.1.99416 WP_002215288.1.99727 WP_002215288.1.99788 WP_002215288.1.99882 WP_002215288.1.99972 WP_002215288.1.99990 YP_001005285.1.77335 YP_002347614.1.25044 gi|386311625|ref|YP_006007681.1| gi|22125138|ref|NP_668561.1| gi|145598893|ref|YP_001162969.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]