SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148245010|ref|YP_001219704.1| from Candidatus Vesicomyosocius okutanii HA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148245010|ref|YP_001219704.1|
Domain Number 1 Region: 59-202
Classification Level Classification E-value
Superfamily CBS-domain pair 8.72e-33
Family CBS-domain pair 0.0022
Further Details:      
 
Domain Number 2 Region: 197-276
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 2.73e-16
Family CorC/HlyC domain-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148245010|ref|YP_001219704.1|
Sequence length 282
Comment magnesium/cobalt efflux protein [Candidatus Vesicomyosocius okutanii HA]
Sequence
MNKEQFSLKSFFLQRLKKRYLHIPLRSSDELLRMLKEAEENYIIDSNSRSIIEGTMQLEK
LEVRDVMVPKSKMVMIEHQSTTKELLDIMIKSSHSRFPIINSDKNKIQGVILAKDLLGFL
VEKQNFEFNYKQYLRDSLFVPESKTLGALLRDFQQKKSHMAIVMDEYGEIAGLVTLEDVL
EQIVGEIEDEHDLEEDNIIDFGEGRFLLKANTPIEEFDEFFKVKLQVENLDTVAGLVIKG
FTRLPEQMDEISLQGFNFKILKTDSRRIHLLEVERSMNGNNA
Download sequence
Identical sequences A5CVQ3
412965.COSY_0875 WP_011930249.1.51471 gi|148245010|ref|YP_001219704.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]