SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150402009|ref|YP_001329303.1| from Methanococcus maripaludis C7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150402009|ref|YP_001329303.1|
Domain Number 1 Region: 67-199
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.04e-25
Family Ribonuclease H 0.0046
Further Details:      
 
Domain Number 2 Region: 3-47
Classification Level Classification E-value
Superfamily L9 N-domain-like 0.000000000000439
Family N-terminal domain of RNase HI 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150402009|ref|YP_001329303.1|
Sequence length 201
Comment ribonuclease H [Methanococcus maripaludis C7]
Sequence
MSKIYAVRKGRKTGLFETWGECENQVKGFSGAEFKSFTSKKDAEIYLNQKTEEKQNNIQS
NEFEKDVMYAWVDGSFNLKNKEYGAGVLTIFNGIEKEIKAKGNNKELSKMRNVAGEILAS
ELAMEYAVSKNVKNLIIYHDYLGIEKWCTGEWKTNKEGTTEYKEKCKNYLKKLNIEFVKV
KAHSGDKNNEIADKLAKESLL
Download sequence
Identical sequences A6VFC6
WP_011976489.1.31125 426368.MmarC7_0082 gi|150402009|ref|YP_001329303.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]