SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150402216|ref|YP_001329510.1| from Methanococcus maripaludis C7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150402216|ref|YP_001329510.1|
Domain Number 1 Region: 75-134
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000000183
Family NfeD domain-like 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150402216|ref|YP_001329510.1|
Sequence length 137
Comment hypothetical protein MmarC7_0289 [Methanococcus maripaludis C7]
Sequence
MELGYITIIIGMGLILLEAFLPGLNFPVAGVAVLIYGIFLLYAPQWALPSAILAGLITAY
IMKRFVYRTGLDVKIGAENLIGEHGDLVDEIGENNYGHVIIHGERWQAKSEIPIKKGSKV
VVTGIEGVSLLIEELSE
Download sequence
Identical sequences A6VFY3
426368.MmarC7_0289 gi|150402216|ref|YP_001329510.1| WP_011976696.1.31125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]