SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150402448|ref|YP_001329742.1| from Methanococcus maripaludis C7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150402448|ref|YP_001329742.1|
Domain Number 1 Region: 6-104
Classification Level Classification E-value
Superfamily GlnB-like 1.02e-27
Family DUF190/COG1993 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150402448|ref|YP_001329742.1|
Sequence length 109
Comment hypothetical protein MmarC7_0523 [Methanococcus maripaludis C7]
Sequence
MKKISAKLLRIYLKEEDKYGKELLINSIIKTLKSNGIAGATVFKGYCGYGTRGFSRIDIL
RLSMNLPAVIECIDYEEKLNDIMPKLVEMVSENGLITVQDIEVFKELKK
Download sequence
Identical sequences A6VGL5
gi|150402448|ref|YP_001329742.1| WP_011976923.1.31125 426368.MmarC7_0523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]