SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150403370|ref|YP_001330664.1| from Methanococcus maripaludis C7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150403370|ref|YP_001330664.1|
Domain Number 1 Region: 68-117
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000183
Family Psq domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150403370|ref|YP_001330664.1|
Sequence length 176
Comment hypothetical protein MmarC7_1450 [Methanococcus maripaludis C7]
Sequence
MIKMSEKYKTYHTSKYLSKKEVDDLIKQGIDEVTMPKSVYEYMEEKNKGALNRLLIFGVD
ISITDQVGRPKKVEADLKKKIIEEIINGKSIRKVAEEYDLKKSTLWDNIKDDMAKIKQEK
FRKMIYDYKELLIEKGKYSDYIETLFYELDMNISNDDLKEAEKILLKIIEYSKKKD
Download sequence
Identical sequences A6VJ87
426368.MmarC7_1450 gi|150403370|ref|YP_001330664.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]