SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150403380|ref|YP_001330674.1| from Methanococcus maripaludis C7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150403380|ref|YP_001330674.1|
Domain Number 1 Region: 8-88
Classification Level Classification E-value
Superfamily Homeodomain-like 2e-18
Family Tetracyclin repressor-like, N-terminal domain 0.0037
Further Details:      
 
Domain Number 2 Region: 84-195
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.00000000000423
Family Tetracyclin repressor-like, C-terminal domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150403380|ref|YP_001330674.1|
Sequence length 197
Comment TetR family transcriptional regulator [Methanococcus maripaludis C7]
Sequence
MDEIDMKANIEDKRKAVMDAALKLFTERGFQGTSTAQISKEAGVATGTLFHYFPTKEDLI
NNLYFEVKGGLSRAMVKDLESQVSFKDRLKKIWDNLVRWGLDNHDEFLFVGQFCNSPYIS
NFTREEVMKEYVFLHTLVEEGLKEGHIKELPSELVMAMFYQNSRIVVEVISGYDSSKDEN
KLIDDGFEIIWNGLTRN
Download sequence
Identical sequences A6VJ97
426368.MmarC7_1461 gi|150403380|ref|YP_001330674.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]