SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150403407|ref|YP_001330701.1| from Methanococcus maripaludis C7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150403407|ref|YP_001330701.1|
Domain Number 1 Region: 1-136
Classification Level Classification E-value
Superfamily Resolvase-like 1.11e-44
Family gamma,delta resolvase, catalytic domain 0.0000809
Further Details:      
 
Weak hits

Sequence:  gi|150403407|ref|YP_001330701.1|
Domain Number - Region: 139-181
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00166
Family Cgl2762-like 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150403407|ref|YP_001330701.1|
Sequence length 183
Comment resolvase domain-containing protein [Methanococcus maripaludis C7]
Sequence
MIIGYARVSTKDQKLERQIDELKKAGCEKIFLEKISGTKKNRPEFDRMFEVLRPGDMVIV
SELTRLSRSTKDLIEIMTRLEEMGVSVKCLKESWLDTSSAHGKLLFTIFAGLAEFERDLI
SERVKSGLKAARSRGRQGGRPKADINQVELALKMYDSKEYEVKQILKATGISKYTLYNYL
KKR
Download sequence
Identical sequences A6VJC4
WP_012068014.1.31125 426368.MmarC7_1490 gi|150403407|ref|YP_001330701.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]