SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150403556|ref|YP_001330850.1| from Methanococcus maripaludis C7

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|150403556|ref|YP_001330850.1|
Domain Number - Region: 4-92
Classification Level Classification E-value
Superfamily GlnB-like 0.000178
Family Prokaryotic signal transducing protein 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150403556|ref|YP_001330850.1|
Sequence length 109
Comment hypothetical protein MmarC7_1641 [Methanococcus maripaludis C7]
Sequence
MRILLKLFVESQNLGKAINALSEGGISGFYLKEYQGMSPGDWKGFLISEEPEMAVKLVNE
LSQDTVVINSIVNIECLGKIKEQVKERLENEKYTLVELPVLGIVVNSPE
Download sequence
Identical sequences A6VJS3
gi|150403556|ref|YP_001330850.1| WP_012068159.1.31125 426368.MmarC7_1641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]