SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|115526586|ref|YP_783497.1| from Rhodopseudomonas palustris BisA53

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|115526586|ref|YP_783497.1|
Domain Number 1 Region: 15-164,213-383
Classification Level Classification E-value
Superfamily Acetamidase/Formamidase-like 1.07e-78
Family Acetamidase/Formamidase-like 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|115526586|ref|YP_783497.1|
Sequence length 409
Comment formamidase [Rhodopseudomonas palustris BisA53]
Sequence
MVDTLIKVDLTQSAYDNENVHNRWHPDVPMVAWVNPGDDFIVETYDWTGGFIKNNDSADD
VRDIDLSIVHFLSGPIGVKGAEPGDLLVVDLLDIGPMKDSQWGFNGFFSKQNGGGFLTDH
FPLAQKSIWDFKGMYTSSRHIPGVNFAGLIHPGLIGCLPDPKMLATWNEREQALIDTNPT
RVPGLANPPFGPTAHMGRLKGDAKAKAAAEGARTVPPREHGGNCDIKDLSRGSKVYFPVY
VPGGGLSMGDLHFSQGDGEITFCGAIEMAGWLHIKVDVIKDGVNKYGIKNPVFKPSPMTP
NYKDYLIFEGISVDEEGKQHYLDVTIAYRQACLNAIEYLKKFGYSGAQAYSILGTAPVQG
HISGVVDVPNACATLWLPTEIFDFDMMPSSAGPIKHIKGDVDMPCSPDK
Download sequence
Identical sequences Q07HR7
WP_011665972.1.72802 gi|115526586|ref|YP_783497.1| 316055.RPE_4597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]