SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|115526797|ref|YP_783708.1| from Rhodopseudomonas palustris BisA53

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|115526797|ref|YP_783708.1|
Domain Number - Region: 8-92
Classification Level Classification E-value
Superfamily Cation efflux protein transmembrane domain-like 0.00392
Family Cation efflux protein transmembrane domain-like 0.025
Further Details:      
 
Domain Number - Region: 91-143
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00693
Family NfeD domain-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|115526797|ref|YP_783708.1|
Sequence length 145
Comment hypothetical protein RPE_4809 [Rhodopseudomonas palustris BisA53]
Sequence
MTELIASMGSWNWLILGFILIALEMLAPGIFLFWLGLAALLVGGMSMLTDPSWQAQLLAF
ALFAISAVPLWRHFARTTSETAPFLNRRADALVGREFTLEKPIVDGVGTVRIDDTIWRIS
GPDIAAGSKIKIVHADGANLTVAAA
Download sequence
Identical sequences Q07H56
gi|115526797|ref|YP_783708.1| WP_011666182.1.72802 316055.RPE_4809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]