SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116688137|ref|YP_833760.1| from Burkholderia cenocepacia HI2424

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116688137|ref|YP_833760.1|
Domain Number 1 Region: 643-1099
Classification Level Classification E-value
Superfamily ALDH-like 1.83e-127
Family ALDH-like 0.000000241
Further Details:      
 
Domain Number 2 Region: 259-608
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.33e-121
Family Proline dehydrohenase domain of bifunctional PutA protein 0.000000000047
Further Details:      
 
Domain Number 3 Region: 89-258
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 3.27e-65
Family N-terminal domain of bifunctional PutA protein 0.000000408
Further Details:      
 
Domain Number 4 Region: 4-45
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.00000000422
Family PutA pre-N-terminal region-like 0.001
Further Details:      
 
Weak hits

Sequence:  gi|116688137|ref|YP_833760.1|
Domain Number - Region: 1147-1293
Classification Level Classification E-value
Superfamily ALDH-like 0.00275
Family ALDH-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116688137|ref|YP_833760.1|
Sequence length 1310
Comment trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase [Burkholderia cenocepacia HI2424]
Sequence
MASTTLGVKVDDLLRSRLKDAAARLERTPHWLIKQAIFAYLERIEHGQLPPELSGHSGVT
ELADGQATDGDDDNSPHPFLEFAQNVQPQSVLRAAITAAYRRPEPECVPFLLGQARLPAN
LQADVQALATKLVEALREKSSGGGVEGLIHEFSLSSQEGVALMCLAEALLRIPDRATRDA
LIRDKISKGDWRSHVGHAPSLFVNAATWGLMITGKLVTTNSEAGLSSALTRLIGRGGEPL
IRKGVDMAMRLMGEQFVTGETISEALANSRKYEARGFRYSYDMLGEAATTEEDAQRYYAS
YEQAIHAIGKAAGGRGIYEGPGISIKLSALHARYSRSQQDRTMSELLPRVRALALLARRY
DIGLNIDAEEADRLELSLDLLEALCFDPELAGWNGIGFVVQGYQKRCPFVIDYLIDLARR
SRHRLMIRLVKGAYWDSEIKRAQVDGLEGYPVYTRKIYTDVSYLACAKKLLGAPDAVYPQ
FATHNAHTLAAIYHLAGQNYYPGQYEFQCLHGMGEPLYEEVTGRDKLNRPCRVYAPVGTH
ETLLAYLVRRLLENGANTSFVNRIADKTVPVKELVADPVDEASKVVPLGAPHAKIPLPRN
LYGDERPNSMGLDLSNEHRLASLSSALLASAHHPWRAAPMLADDALADAPARDVRNPADQ
RDVVGTVSEATSEHVSAALAHAVAAAPIWQATPVDARADCLVRAADLLEAQMHTLMGLIV
REAGKSLPNAIAEIREAVDFLRYYAAQIRGEFSNDTHRPLGPVVCISPWNFPLAIFMGQV
AAALAAGNTVLAKPAEQTPLIAAQAVRLLREAGVPAGAVQLLPGTGETVGAALVADPRTR
AVMFTGSTEVARLINKTLAARLDPDGKPIPLIAETGGQNAMIVDSSALAEQVVADVMQSS
FDSAGQRCSALRVLCLQDDVADRTLTMLKGAMHELALGNPDRLSTDVGPVIDAEAKQTID
THVAAMKDKGHAVTQLPMPDACAHGTFVPPTLIEIGSIDELKREVFGPVLHVVRYRRSQL
DKLLEQIRATGYGLTLGIHTRIDETIAHVISNAHVGNIYVNRNVIGAVVGVQPFGGEGLS
GTGPKAGGALYLQRLLATRPSGLPRALAQSLVADGATESDARGNPAAALTTLRDWLIEQR
EPALAARCDGYLAQVPAGATAVLSGPTGERNTYTLGPRGTVLCVAATPGGARAQFAAVLA
TGNRALFAGAAGEALVAALPASLKAHAAVRKQADAPFDAVLFEGDSDELQTLVKDVAQRP
GPIVSVQGVSAGAFENGDAEDYALERLLTERSVSVNTAAAGGNANLMTIG
Download sequence
Identical sequences WP_011546794.1.101155 WP_011546794.1.21535 WP_011546794.1.24953 WP_011546794.1.43430 WP_011546794.1.4378 WP_011546794.1.50701 WP_011546794.1.88043 WP_011546794.1.90247 WP_011546794.1.90674 WP_011546794.1.95150 WP_011546794.1.96618 WP_011546794.1.9804 WP_011546794.1.98478 WP_011546794.1.98955 gi|162218045|ref|YP_622811.2| 331271.Bcen_2942 331272.Bcen2424_0113 gi|116688137|ref|YP_833760.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]