SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116688150|ref|YP_833773.1| from Burkholderia cenocepacia HI2424

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116688150|ref|YP_833773.1|
Domain Number 1 Region: 139-293
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 4.19e-37
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.0083
Further Details:      
 
Domain Number 2 Region: 70-121
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000627
Family AraC type transcriptional activator 0.0087
Further Details:      
 
Domain Number 3 Region: 20-63
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000896
Family AraC type transcriptional activator 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116688150|ref|YP_833773.1|
Sequence length 293
Comment AraC family transcriptional regulator [Burkholderia cenocepacia HI2424]
Sequence
MTPAETKTDPPAWVRYAASVARVHAYISAHLDGPLDLNRLAEVACLSPYHWQRVYRALYG
ESIVLTVRRMRIVRASEDLVCTARPLDEIARRAGYGSTHAFARAFRDAYGVLPAQHRRTG
THRPIYPLQRGEADMFKHEVEIRRLPELRGYAVTHTGAYMKVGDAFGRIGAWVGQHGLIG
PGAKMIGIFYDDPDTTPEAQLRAKACFMPADGAPDVAPVPPVERVTIAGGEYAVLLHTGP
YADLKTAYQWLYGDWLRHSGREAADAPPFELYLNTPMDTAPADLRTEIHLPLR
Download sequence
Identical sequences A0A0H2XUF2 A0A2K0MTY1
gi|107024471|ref|YP_622798.1| gi|116688150|ref|YP_833773.1| WP_011546782.1.43430 WP_011546782.1.5376 WP_011546782.1.96618 331271.Bcen_2929 331272.Bcen2424_0126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]