SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116688466|ref|YP_834089.1| from Burkholderia cenocepacia HI2424

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116688466|ref|YP_834089.1|
Domain Number 1 Region: 16-288
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 1.43e-97
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.000000171
Further Details:      
 
Domain Number 2 Region: 289-313,359-443
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 1.7e-21
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116688466|ref|YP_834089.1|
Sequence length 460
Comment cytochrome b/b6 domain-containing protein [Burkholderia cenocepacia HI2424]
Sequence
MAADNKEVSTTGFTGWIDQRFPLTSTWKKHVSEYYAPKNFNFWYFFGSLALLVLVNQIVT
GIFLTMNYKPDSTLAFASVEYIMREVPWGWLIRYMHSTGASMFFVVVYLHMFRGLLYGSY
RKPRELVWIFGCAIFLCLMAEAFFGYLLPWGQMSFWGAQVIVNLFSAIPFVGPDLSLWIR
GDYVVSDVTLNRFFAFHVIAIPLVLVGLVVAHLVALHEVGSNNPDGIEIKAKKDENGVPL
DGIPFHPYYSVHDFLGVCVFLMVFALIVFFSPEMGGYFLEANNFVPANPLQTPPEIAPVW
YFTAFYAMLRATTDPFKIVLMIVIALLGVLALIRARGKWKVGLPVLAAAIVVFMYLTESK
FWGVVVMGSAVISLFFLPWLDRSPVKSIRYRPLFHKVFLGIFVAAFLTLAFLGTRPPSPA
ATLIAQACALIYFAFFLGMPVWTPLGTFKQPPERVRFKPH
Download sequence
Identical sequences WP_011694116.1.96618 gi|116688466|ref|YP_834089.1| 331272.Bcen2424_0442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]