SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116692725|ref|YP_838258.1| from Burkholderia cenocepacia HI2424

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116692725|ref|YP_838258.1|
Domain Number 1 Region: 15-164,213-383
Classification Level Classification E-value
Superfamily Acetamidase/Formamidase-like 6.8e-78
Family Acetamidase/Formamidase-like 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|116692725|ref|YP_838258.1|
Sequence length 412
Comment formamidase [Burkholderia cenocepacia HI2424]
Sequence
MPETLIKVDLNQSAYENEQVHNRWHPDIPMACWVKPGDDFILETYDWTGGFIKNDDSADD
VRDIDLSIVHFLSGPVGVHGAEPGDLLVVDLLDIGAKADSQWGFNGFFSKTNGGGFLTDH
FPSAQKSIWDFHGVYTSSRHIPGVNFAGLIHPGLIGCLPDPTLLETWNARETGLIATAPE
RVPPLANPPFAATAHMGKLAGDARDQAAAQGARTVPPREHGGNCDIKDLSRGSKVFFPVY
VDGAGLSVGDLHFSQGDGEITFCGAIEMAGWVHMRVNLIKGGMAKYGIRNPVFQPSPITP
TYNDYLIFEGISVDEQGGQHYLDVTTAYRQACLNAIEYLKKFGYSGAQAYSLLGCAPVQG
HISGVVDIPNACATLWLPTQIFDFDIRPNADGPIRYIQGGVDLPCSPDLAKA
Download sequence
Identical sequences A0A0H2XVX1 A0A2K0MM29 A2VY78 V4ZYA4
gi|107026091|ref|YP_623602.1| WP_006478798.1.43430 WP_006478798.1.5376 WP_006478798.1.96618 331271.Bcen_3737 331272.Bcen2424_4631 gi|116692725|ref|YP_838258.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]