SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116693650|ref|YP_839183.1| from Burkholderia cenocepacia HI2424

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116693650|ref|YP_839183.1|
Domain Number 1 Region: 4-115
Classification Level Classification E-value
Superfamily DOPA-like 1.96e-42
Family DOPA dioxygenase-like 0.00000473
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116693650|ref|YP_839183.1|
Sequence length 117
Comment aromatic ring-cleaving dioxygenase-like protein [Burkholderia cenocepacia HI2424]
Sequence
MAALDTTAIDSWHAHVYFDAASRDAAWAFRQVVDARFGAVIELGRFHERLVGPHPAWSYQ
IAFDAARFDDIVPWLVLNHGALDIFLHPNTHDELRDHRDCAVWIGKSYTLNLDALAG
Download sequence
Identical sequences A0A0H2Y100 A0A2K0MRK3 B1K3U8
331271.Bcen_5303 331272.Bcen2424_5557 406425.Bcenmc03_4715 gi|116693650|ref|YP_839183.1| WP_011548877.1.43430 WP_011548877.1.5376 WP_011548877.1.90614 WP_011548877.1.96618 gi|170737075|ref|YP_001778335.1| gi|107027639|ref|YP_625150.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]