SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116691769|ref|YP_837302.1| from Burkholderia cenocepacia HI2424

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116691769|ref|YP_837302.1|
Domain Number 1 Region: 453-589
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 5.76e-35
Family Flavohemoglobin, C-terminal domain 0.00077
Further Details:      
 
Domain Number 2 Region: 351-451
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 2e-26
Family Ferredoxin reductase FAD-binding domain-like 0.00045
Further Details:      
 
Domain Number 3 Region: 575-683
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 6.82e-20
Family 2Fe-2S ferredoxin-related 0.031
Further Details:      
 
Domain Number 4 Region: 183-287
Classification Level Classification E-value
Superfamily FMN-binding split barrel 0.00000000194
Family PNP-oxidase like 0.017
Further Details:      
 
Weak hits

Sequence:  gi|116691769|ref|YP_837302.1|
Domain Number - Region: 48-146
Classification Level Classification E-value
Superfamily FMN-binding split barrel 0.005
Family PNP-oxidase like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116691769|ref|YP_837302.1|
Sequence length 692
Comment pyridoxamine 5'-phosphate oxidase-like FMN-binding protein [Burkholderia cenocepacia HI2424]
Sequence
MNAPTAVVPGWELDTAPFHAGELAVQQRAGVTDAASAAGRRGIRRFMPDQHRTFFAQLPF
FVLGGVDAHGQPWATLRAGAPGFVTSPDARTLRIAAPALPGDPLAGAWQAGAPLGGLGIE
FDTRRRNRVNGVVRAVDGDALTIAVEQSFGNCAKYIQGRKPTFVARDVEASVAPDVSDAL
SGADRALLAQADTFFVASANTSAEAGAARGADVSHRGGMPGFVRVDDARTLTTPDFSGNR
FFNTLGNLQHDPRAGLLFIDFDSGDVLYVAARAEIVWDGPDVASFDGAQRVVRFHVREVR
RVRAVLPFRWSAVERAPQFAAMAAAATATALGRAAATAGPAPSAVAPSPAPAWRSLRIAK
IVDEARAIRSFHFEPADGGALPAYEAGQHLTLRIALPGSDAPAIRSYTLSDAPGGTQYRI
TVKREGRVSAWLHDHAQAGMTLDAQMPRGRFTFDLASPRPAVLVSAGIGITPMIAMLRRA
LADDTPSRRIVFVHGAREAADRPFAAELARLAAADARLSLHWFDSRPQESTVAQAGRIDI
GQLKRVLSFDDYDFYLCGPAAFMRDLYDGLRALNVPDERIRFEAFGPSSVSRSATRAAAA
PAAASVPVVFRRTGRDAAWTPADGTLLEFAEGQRVAVPSECRAGSCGTCATRVLSGAVEY
EQTPDAPVEPGCALLCVARPAQGATQPLVLDR
Download sequence
Identical sequences A0A0H2XYJ5 A0A2K0MPJ6
WP_011548331.1.43430 WP_011548331.1.5376 WP_011548331.1.96618 gi|116691769|ref|YP_837302.1| 331271.Bcen_4692 331272.Bcen2424_3671 gi|107027034|ref|YP_624545.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]