SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|124027078|ref|YP_001012398.1| from Hyperthermus butylicus DSM 5456

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124027078|ref|YP_001012398.1|
Domain Number 1 Region: 12-134
Classification Level Classification E-value
Superfamily Single hybrid motif 1.36e-45
Family Biotinyl/lipoyl-carrier proteins and domains 0.000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|124027078|ref|YP_001012398.1|
Sequence length 139
Comment glycine cleavage system protein H [Hyperthermus butylicus DSM 5456]
Sequence
MAGEIRVGDYLVLTDRRYTKSDEWIKEEDGVVTVGITDYAQKKLRDIVGVDLPEKGRRVQ
AGEAVASIESVKAAADVYAPVSGEVVEVNERLYDEPELLNRDPYGEGWMFKIKIEDRSEL
EKLLSPEEYAEKIRKEEGL
Download sequence
Identical sequences A2BJ92
415426.Hbut_0181 WP_011821370.1.50451 gi|124027078|ref|YP_001012398.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]