SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|124027096|ref|YP_001012416.1| from Hyperthermus butylicus DSM 5456

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124027096|ref|YP_001012416.1|
Domain Number 1 Region: 183-277
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000000000235
Family Multidrug resistance efflux transporter EmrE 0.014
Further Details:      
 
Domain Number 2 Region: 35-132
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.000000209
Family Multidrug resistance efflux transporter EmrE 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|124027096|ref|YP_001012416.1|
Sequence length 289
Comment hypothetical protein Hbut_0199 [Hyperthermus butylicus DSM 5456]
Sequence
MLAPWAALLVALFGISTAAPLARLAGVDGVTAAWWRLLVGSLVTLAASAIVGRLPRSSVA
VRSLPAGVLLAAHLALWLESLRHASVASSTGIVVSYPVIAAAYEALVERSATPRMVLGVV
LGFSGVAILSTPWAGATMLGALMAFSAAVAATAYFLLGRRLRVRGVSTLEYTAVVYTAAF
LAVAVYAAAAGVKAWSPPRGSIPYLIALGLVPMLLGHTMLNYALAFYPTAVVTSIALLEP
YGASLLAWLLLDEPPPPASLPGLLLTVTGAWLTLYRTQPGSTARKLGSL
Download sequence
Identical sequences A2BJB0
WP_011821388.1.50451 gi|124027096|ref|YP_001012416.1| 415426.Hbut_0199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]