SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|124027183|ref|YP_001012503.1| from Hyperthermus butylicus DSM 5456

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124027183|ref|YP_001012503.1|
Domain Number 1 Region: 196-274
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.000000000000222
Family Multidrug resistance efflux transporter EmrE 0.016
Further Details:      
 
Domain Number 2 Region: 60-137
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000000602
Family Multidrug resistance efflux transporter EmrE 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|124027183|ref|YP_001012503.1|
Sequence length 278
Comment hypothetical protein Hbut_0286 [Hyperthermus butylicus DSM 5456]
Sequence
MTRTRGLAYAVTAAILWGSIGVAYRLALSHGASREWLILGRPLIGGLGSLAATVLGYGRP
GRWSLLVGAGTLAPLVVVYLFAVELLGAALASILLYTAPIWVALLGLLLLGEKPGTRGAL
AVALGFTGSFLIAFEGWARASLVAVLVGLAAGLLYAAYMLAARYALRHGAGELEVGLHSQ
PFTAMAVAAVTKPGELPATVDLPWMLYLGVATMLVPYVLHARALRLLEAYRVSVVSLIEP
LAATVLAALLLGEKLTALQLVGATLILAASLLALEKGR
Download sequence
Identical sequences A2BJJ7
gi|124027183|ref|YP_001012503.1| 415426.Hbut_0286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]