SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|124027259|ref|YP_001012579.1| from Hyperthermus butylicus DSM 5456

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124027259|ref|YP_001012579.1|
Domain Number 1 Region: 125-197
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000808
Family Myf domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|124027259|ref|YP_001012579.1|
Sequence length 233
Comment RNA-binding protein [Hyperthermus butylicus DSM 5456]
Sequence
MSDTRNDYRILVAEHAVSLLENIVRARRIPIPVNWHEVEALVSELRSLIVRIKYSFIPPT
MLAGSEEVERVREYAGKLAKTLLSKERLAGAKLDSKTRMAIAEARYALRTLYGLGYRLSL
GDENDALHAVDIECVEVLTITKHPSAEKLFVTRARGVLGYTIVTNLPDVRKGELRAAAIL
PPREFYGEISEAMYCSGPLNTDVCKPGRRPPANLIDRGSVEAVIYNIVGRKAR
Download sequence
Identical sequences A2BJS3
WP_011821552.1.50451 415426.Hbut_0362 gi|124027259|ref|YP_001012579.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]