SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|124027280|ref|YP_001012600.1| from Hyperthermus butylicus DSM 5456

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124027280|ref|YP_001012600.1|
Domain Number 1 Region: 6-188
Classification Level Classification E-value
Superfamily LigT-like 4.01e-41
Family 2'-5' RNA ligase LigT 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|124027280|ref|YP_001012600.1|
Sequence length 193
Comment 2'-5' RNA ligase, Lig T [Hyperthermus butylicus DSM 5456]
Sequence
MSYERIRAFIAVDIEDPSIVAKLVQIRDSFVATGAPMKPVEDQNLHITLRFLGNIPLSLV
DEIEKIIRDAKPRRVVIRIRGVGAFPSPARPRVVWVGVEEGEGAKELERLYREIERGLRR
LGFKPEREEFVPHVTLARLKGSRNIDRVVKLLNELADIEVGEIVLESVRLKQSILTPRGP
IYKTLREVKAVEA
Download sequence
Identical sequences A2BJU4
gi|124027280|ref|YP_001012600.1| WP_011821573.1.50451 415426.Hbut_0388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]