SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|124027434|ref|YP_001012754.1| from Hyperthermus butylicus DSM 5456

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124027434|ref|YP_001012754.1|
Domain Number 1 Region: 1-140
Classification Level Classification E-value
Superfamily Nucleoside diphosphate kinase, NDK 1.83e-59
Family Nucleoside diphosphate kinase, NDK 0.00000459
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|124027434|ref|YP_001012754.1|
Sequence length 142
Comment nucleoside diphosphate kinase [Hyperthermus butylicus DSM 5456]
Sequence
MPVERTFVMIKPDGVKRGLVGEIIARFERKGLKIKALKMKWLTREEAEKLYEVHRGKPFF
EDLVNFVTSGPVVAMILEGDSAIEVVRLMIGPTDGRKAPPGTIRGDYALDIGANVIHASD
SKESYEREYKVFFSDDEIVGDY
Download sequence
Identical sequences A2BK98
gi|124027434|ref|YP_001012754.1| WP_011821727.1.50451 415426.Hbut_0549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]