SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|124027559|ref|YP_001012879.1| from Hyperthermus butylicus DSM 5456

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124027559|ref|YP_001012879.1|
Domain Number 1 Region: 108-221
Classification Level Classification E-value
Superfamily Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain 7.85e-25
Family Dihydrodipicolinate reductase-like 0.0007
Further Details:      
 
Domain Number 2 Region: 15-137
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.55e-16
Family Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|124027559|ref|YP_001012879.1|
Sequence length 253
Comment hypothetical protein Hbut_0678 [Hyperthermus butylicus DSM 5456]
Sequence
MDEGVVENAELVALYDVARERCEKLASELKRFKPRIASCFEELLGSKPDVVVEAASQQAV
REYGLRVLESGADLIVLSVGALMDRDLLAKLVEAARRKRRHIYTPSGAIAGLDAVYALSL
NGIRSVRLVTRKPPRALKDAPYVREKGINLDETREPTTIYVGPASEAVKYFPANVNVAAA
LSLAAKKEATVEIVADPTVERNIHEIHVDSEASKLTIRVENTPSPMNPRTSYLAALSAIA
LLKRLADERLWIA
Download sequence
Identical sequences A2BKM3
415426.Hbut_0678 gi|124027559|ref|YP_001012879.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]