SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|124027565|ref|YP_001012885.1| from Hyperthermus butylicus DSM 5456

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124027565|ref|YP_001012885.1|
Domain Number 1 Region: 113-132,174-389
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 6.29e-56
Family D-glucarate dehydratase-like 0.0000317
Further Details:      
 
Domain Number 2 Region: 3-126
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 5.79e-20
Family Enolase N-terminal domain-like 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|124027565|ref|YP_001012885.1|
Sequence length 393
Comment muconate cycloisomerase I [Hyperthermus butylicus DSM 5456]
Sequence
MPRISRVEYFVVEARIRGVFRIAYSAASVSRSVVVKVVLEDGTIGFGEASPSKMVTWETI
DSIGSYVGLVSGQLRGLSLPEEMGKALRVIHGYGLGFSSARAALESAILDAVGKLFGVPV
YNLLGGRVAERLVTDYTVSIPDLGVARDIAGRSGRGWELYAETIEYIVGLRSKPPEEPPI
PVPSIQGFNVLKVKVGTGDPLLDAQLVLAAYEASRGRARIRVDANQAWSPKEAVRVIHRL
ENTLGDALELVEQPVPAWNLEGLRYVKERVDVPIAADESARSPVEAARVAAMGAADVINI
KIAKAGGPLQAARIASLAEAHGLQVMWGCMAETGLGIAQALHAALTSTATRYVDLDSPLF
LEKDPARNSPRYRATAEGVTVEPAPGPGLATEI
Download sequence
Identical sequences A2BKM9
415426.Hbut_0684 gi|124027565|ref|YP_001012885.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]