SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|124027572|ref|YP_001012892.1| from Hyperthermus butylicus DSM 5456

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124027572|ref|YP_001012892.1|
Domain Number 1 Region: 31-88
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000674
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|124027572|ref|YP_001012892.1|
Sequence length 98
Comment transcriptional regulator, HTH-type [Hyperthermus butylicus DSM 5456]
Sequence
MIAKTSGRNGGSTASSQAAGGPEVVLGEGVLDDRDKAILHLLAREGVIGVSEIARRLALG
KSVVWRKLQKLTAMGLVERVVVNGRPLYRLRPVEEPRN
Download sequence
Identical sequences A2BKN6
415426.Hbut_0691 gi|124027572|ref|YP_001012892.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]