SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|124027617|ref|YP_001012937.1| from Hyperthermus butylicus DSM 5456

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124027617|ref|YP_001012937.1|
Domain Number 1 Region: 54-86
Classification Level Classification E-value
Superfamily Band 7/SPFH domain 0.0000000693
Family Band 7/SPFH domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|124027617|ref|YP_001012937.1|
Sequence length 86
Comment hypothetical protein Hbut_0738 [Hyperthermus butylicus DSM 5456]
Sequence
MNGVAALLALVLGALVSALVALGIRVIRPWEVDIYIRLGKFMGILRPGLHWVPPFISNVY
RIDLRTQVVDVPKQEVITRDNSPVVV
Download sequence
Identical sequences A2BKT1
gi|124027617|ref|YP_001012937.1| 415426.Hbut_0738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]