SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|124027618|ref|YP_001012938.1| from Hyperthermus butylicus DSM 5456

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124027618|ref|YP_001012938.1|
Domain Number 1 Region: 1-61
Classification Level Classification E-value
Superfamily Band 7/SPFH domain 0.000000000000017
Family Band 7/SPFH domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|124027618|ref|YP_001012938.1|
Sequence length 144
Comment hypothetical protein Hbut_0739 [Hyperthermus butylicus DSM 5456]
Sequence
MELDEIPYNRAAINAKLRSILDEATDKWGVRAESIEIREVEPSPTVKKAMEEQTAAERER
RAAILSAEGERMAMILRALGEAQRLRILAAGASALHPAAVTVLGLETLAKLADTPSTKLV
LPYELTRLAEAVAAHLGAAAAQPP
Download sequence
Identical sequences A2BKT2
gi|124027618|ref|YP_001012938.1| 415426.Hbut_0739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]