SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|124027732|ref|YP_001013052.1| from Hyperthermus butylicus DSM 5456

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124027732|ref|YP_001013052.1|
Domain Number 1 Region: 6-236
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.15e-40
Family RecA protein-like (ATPase-domain) 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|124027732|ref|YP_001013052.1|
Sequence length 274
Comment ATPase [Hyperthermus butylicus DSM 5456]
Sequence
MASTKPSIERLPTGVPGFDKLIQGGIPRGFFVAVVGEPGTGKTIFSIHFIAEGIRQGDKN
IYVTTEETRESIIKQAAMFGFDFEKAIDDGKLVIIDALMGRHDDPWSLTELDVETLVNKI
IEAKRYLGYGRARLVIDSMSAFWLDKPAMARRYSYYVKRILARWDFTALLTSQYAVTTSL
GFGFGIEHVADGIIRFRKAVVRGELRRYVIIEKMRQTEHSLRMHEIEIRDGVGMRVKAPT
QLRKEDTALPQSVAAKMLAAELQKLLEVPLGDEE
Download sequence
Identical sequences A2BL46
WP_011822025.1.50451 415426.Hbut_0856 gi|124027732|ref|YP_001013052.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]