SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|124027743|ref|YP_001013063.1| from Hyperthermus butylicus DSM 5456

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124027743|ref|YP_001013063.1|
Domain Number 1 Region: 8-176
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.02e-68
Family Inorganic pyrophosphatase 0.000000312
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|124027743|ref|YP_001013063.1|
Sequence length 181
Comment inorganic pyrophosphatase [Hyperthermus butylicus DSM 5456]
Sequence
MASIHERIGPGEKAPDIVNVLVEIPMGSNVKYEFDEEAEVIRVDRFLYTSMVYPFNYGFI
PGTLEEDGDPVDVLVISNQPVLPGTIIEVRPIGLLVMEDEEGPDSKVIAVPKDKLDPSFK
NIKSVEDLPEILREKIKHFFEHYKELEPGKWVKVREWRGPEEAKRKIAEAIERFKKSKSE
G
Download sequence
Identical sequences A2BL57
gi|124027743|ref|YP_001013063.1| 415426.Hbut_0867 WP_011822036.1.50451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]