SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|124027784|ref|YP_001013104.1| from Hyperthermus butylicus DSM 5456

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124027784|ref|YP_001013104.1|
Domain Number 1 Region: 147-433
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 7.78e-114
Family Enolase 0.000000292
Further Details:      
 
Domain Number 2 Region: 13-145
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 8.3e-49
Family Enolase N-terminal domain-like 0.00000672
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|124027784|ref|YP_001013104.1|
Sequence length 447
Comment enolase (2-phosphoglycerate dehydratase) [Hyperthermus butylicus DSM 5456]
Sequence
MSLPVGYDDSYIISRVRARMILDSRGNPTVEVEVVTRGGGFGRAAAPAGASKGKHEALEL
RDGGKKFGGRGVDRALFNVNHVIAPRITGLDARMQRLIDSIMVDLDGTPNKSRLGANAIV
ATSLAVAKAAADTAGMPLYRYLGGTGTFVMPVPLMNIINGGAHAGNELSFQEFMIAPVGA
DSFSEALRIGVEVYQMLKKYLKDKYGASAINVGDEGGYAPPMKSNKEALDALVEAIKLAG
YEPGADVVLGIDVAASQFYDAESGTYSVDGHRLSAEELLDYYLVMVDEYPIRSIEDPFYE
EDYESFAKLTSKLLGRVLIVGDDLYVTNIGRLVRGIELKATTAALLKVNQVGTLTEALDY
AYTAMASNLKVIVSHRSGETEDTTIAHLAVALRAGFIKTGAPARGERTAKYNELLRIEED
CSGECIYPGIRAYQSLHPVTAAYQLPA
Download sequence
Identical sequences A2BL98
415426.Hbut_0911 WP_011822077.1.50451 gi|124027784|ref|YP_001013104.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]