SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|124027795|ref|YP_001013115.1| from Hyperthermus butylicus DSM 5456

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124027795|ref|YP_001013115.1|
Domain Number 1 Region: 4-237
Classification Level Classification E-value
Superfamily Purine and uridine phosphorylases 7.33e-68
Family Purine and uridine phosphorylases 0.00000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|124027795|ref|YP_001013115.1|
Sequence length 245
Comment S-methyl-5-thioadenosine phosphorylase [Hyperthermus butylicus DSM 5456]
Sequence
MKPQHIRVSPDRVAAKVVVVGDPARARFIAEHLLEDAELVNEERCFHLYTGFYRGERISV
AVHGVGAASSAIVFEELRMLGAKVMVRLGTAGALMPELDIGDMVVATGAAYVHGGTIGSY
VPDACMATAPNPLLLTKLYDYAKRIHGRVVLGPVFSSDAFYAEDPEFAKKWFSRGIVAVE
MEVATLYALAALRRFDAAAALVISDNLVVPGKEELRHHRELEPYVEKAAKAVLEALRDYN
PSNIS
Download sequence
Identical sequences A2BLA9
415426.Hbut_0922 gi|124027795|ref|YP_001013115.1| WP_011822088.1.50451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]