SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|124027838|ref|YP_001013158.1| from Hyperthermus butylicus DSM 5456

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124027838|ref|YP_001013158.1|
Domain Number 1 Region: 253-613
Classification Level Classification E-value
Superfamily SIS domain 6.12e-93
Family double-SIS domain 0.00000228
Further Details:      
 
Domain Number 2 Region: 2-230
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 2.06e-68
Family Class II glutamine amidotransferases 0.00000314
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|124027838|ref|YP_001013158.1|
Sequence length 613
Comment glucosamine-fructose-6-phosphate aminotransferase [Hyperthermus butylicus DSM 5456]
Sequence
MCGIVGITADGEIVGSITRMLVDGLKRLEYRGYDSAGFALIECGTARILVFKDKGRISHV
VEKYGIEAYCSHTGIAHTRWATHGEPSQRNAHPHIDCRSEIAVVHNGIIKNFAELRELLA
SKGHMFRSDTDTEVIAHLFEEYVSKGLDGLEALRKIVQVLEGAYAIAIINAREPLRIYFA
RRVSPLIIGLGEGFNMVSSDIPSILPYTRRVIVLEDGEYGFIEPYKVYIEKDGKPINWRT
RVIRVEWSIEDAEKGGYPHYMLKEIMEQPRVLYETYTGLLSSKELAEAAKLIASARKVFI
TGAGTSYHAGLVFAYYIARYAKRVATPFIASEYTVYSDVADEDSVLIAVSQSGETIDTLQ
ALRAFKSKGAKIIAVSNVLGSTIPRESHTTIYTRAGPEIGVAATKTFLTQVLALTSLALT
LATEEGTITTTEYKKAIEELALAGRAAARSIDASLRILDKLVLVLKNKGNMYILSRGIGV
PLAYEAALKVKEVSYIHAEAYPAGESKHGPIALVERDFPVIFLGVPPEDVLLEKLQGNVM
EMKARGAHTIVIGTTPYGKLEGVDVFIDVGSYDELLIPYAIIPPAQLLAYKLAVALNRDP
DKPRNLAKTVTVE
Download sequence
Identical sequences A2BLF2
gi|124027838|ref|YP_001013158.1| 415426.Hbut_0965 WP_011822131.1.50451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]