SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|124027888|ref|YP_001013208.1| from Hyperthermus butylicus DSM 5456

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124027888|ref|YP_001013208.1|
Domain Number 1 Region: 8-109
Classification Level Classification E-value
Superfamily GlnB-like 2.48e-35
Family Divalent ion tolerance proteins CutA (CutA1) 0.0000647
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|124027888|ref|YP_001013208.1|
Sequence length 111
Comment periplasmic divalent cation tolerance protein cutA [Hyperthermus butylicus DSM 5456]
Sequence
MTSTAPIEGGVVVVYITTPRGKGKEIAQKLLEERLAACINITPVESGYWWQGKIENDQED
LLIVKTSMDKLPKLIEKVKEIHPYQVPEIVAVPVVACYAEYCRWVREETHQ
Download sequence
Identical sequences A2BLK2
WP_011822181.1.50451 415426.Hbut_1018 gi|124027888|ref|YP_001013208.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]