SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|124028001|ref|YP_001013321.1| from Hyperthermus butylicus DSM 5456

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124028001|ref|YP_001013321.1|
Domain Number 1 Region: 109-174
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000000000793
Family EDF1-like 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|124028001|ref|YP_001013321.1|
Sequence length 200
Comment hypothetical protein Hbut_1139 [Hyperthermus butylicus DSM 5456]
Sequence
MTAQRRTTPLYCEMCGAPITGRAYRIVVEGTEMMVCERCYSRYMERSMRTGTDEPLRYRL
TTTRRTTQPAPREPAASAVPALRRQQARRPAALRKRETSLGVVERYEVVEDYAERIRRAR
QRLGLTQRELAQKVRVGENVIKRIEAGTLVPPIDLARRLERVLGVKLLEPVVEEELEASP
RSRRDEFYLTLGDIAEIRED
Download sequence
Identical sequences A2BLW5
gi|124028001|ref|YP_001013321.1| WP_011822294.1.50451 415426.Hbut_1139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]