SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|124028078|ref|YP_001013398.1| from Hyperthermus butylicus DSM 5456

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124028078|ref|YP_001013398.1|
Domain Number 1 Region: 9-135
Classification Level Classification E-value
Superfamily N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 1.7e-40
Family N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 0.00031
Further Details:      
 
Domain Number 2 Region: 138-273
Classification Level Classification E-value
Superfamily Translational machinery components 3.1e-37
Family ERF1/Dom34 middle domain-like 0.001
Further Details:      
 
Domain Number 3 Region: 270-369
Classification Level Classification E-value
Superfamily L30e-like 1.59e-18
Family ERF1/Dom34 C-terminal domain-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|124028078|ref|YP_001013398.1|
Sequence length 370
Comment peptide chain release factor 1 [Hyperthermus butylicus DSM 5456]
Sequence
MQQASQLMVDKRTLKQIIRELKRWKAPATVLLTLYIPPGRPISDVVSLLRTEYSITDNIK
LKRTRDAVQRALAAAMDRLTRIQKVPPNGLAVFCGEDMETKDFICFVFSPPEPVPVFFYR
TDKWFHTEFLEEMIEQEETYGLVIIERDQATIGLLKGTRIQVLEELEGYVPGKHHKGGQS
QRRFDRQIEQFVKGFYREVAEAMNKHFLPLIEKGVLRAIILGGPGYAKQDFLEEARDFLD
YRVRQKIASKTVDVAYQGEAGLRELVIKAADIIEQNKYAELAKAVEEFKLHLAKDDGLAV
YGDKMVKTALEMGALKYIIVDEERPDADTLAEEAKKYGTKVYFLSGDLPEAEWIRKTFKG
LVGVLHFRIM
Download sequence
Identical sequences A2BM42
415426.Hbut_1221 WP_011822371.1.50451 gi|124028078|ref|YP_001013398.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]