SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|124028080|ref|YP_001013400.1| from Hyperthermus butylicus DSM 5456

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|124028080|ref|YP_001013400.1|
Domain Number - Region: 62-103,135-159
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000735
Family Cgl2762-like 0.059
Further Details:      
 
Domain Number - Region: 160-201
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.0034
Family Rad50 coiled-coil Zn hook 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|124028080|ref|YP_001013400.1|
Sequence length 207
Comment hypothetical protein Hbut_1223 [Hyperthermus butylicus DSM 5456]
Sequence
MAVQRELKIDLSHVPLRPTSKKEIKLLETALIVATLYRPEIIELIRDPLEKATWLDSLAI
AAAALAREKAGYSISQIAEELGRSETTIRAHLQGKTKAGKIVRETYEKLVRGEPTISLPF
AVAEEGDECRRELEKLREELKELREENYRLREELEKTREVEDVKQQLEEIREQLEELERE
RDELAKRVKELEEKAALLDEIRRVLGC
Download sequence
Identical sequences A2BM44
415426.Hbut_1223 WP_011822373.1.50451 gi|124028080|ref|YP_001013400.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]